KEGG   Gallus gallus (chicken): 418406
Entry
418406            CDS       T01006                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X2
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04120  Ubiquitin mediated proteolysis
gga04144  Endocytosis
gga04625  C-type lectin receptor signaling pathway
gga04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    418406 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    418406 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    418406 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    418406 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    418406 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    418406 (CBLB)
   04121 Ubiquitin system [BR:gga04121]
    418406 (CBLB)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     418406 (CBLB)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    418406 (CBLB)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    418406 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 UBA zf-RING_4
Other DBs
NCBI-GeneID: 418406
NCBI-ProteinID: XP_004938335
CGNC: 11434
Ensembl: ENSGALG00000015351
Position
1
AA seq 981 aa
MLRGEERPPERRGAGEGAGQPELRQPHFAGERGDHSLPGAVSCATYGPPGSQMANSQNGR
NPRKGRILGFIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYIL
DILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEE
QSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAADFWRKFFGDKTIVPWK
VFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISIFEFDIFTRLFQPWGSILRNWNFLAV
THPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKP
LFQALIDGSREGFYLFPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKI
CAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDENSRC
CSIIDSFSMPMLDLDDDDDREESLMMNRLASVRKCNERQNSPVTSPGSSPLSQRRKPLPD
PLQIPHLSLPPVPPRLDLIQKGVARSPCASPTGSPKSSPCMVRKQDKPLPAPPPPLRDPP
PPPPERPPPIPPDNRISRHSHHPESVPSRDQPMPLEGWCPRDVFGTSQLVGSRTGSDTSP
KPGLTAVSNINGRHNRISSEQGFMRKHRRHELPVEGAKVFSNGHLINEEYDVPPRLSPPL
PGASTIPSIKCPVSSANSLSDKSRDHTDDDDEYKVPPSHSIILSSQPPHCHNIKAVARVC
ENGQCAGVTNGTHSATSDVKKSKHPELGEDAFDSSPPSLPPPPPPPARHSITEHTKPSGS
GSRPPSGHELFLHPDPHFDPMTGHVPLPPVRRVTGENVKTNRTSQDYDQLPPSSDGSQAP
ARPPKPLPRRTAPEIHHRKAFNSDSSTENVDAKIAKLMGEGYSFEEVKRALEIAQNNVDV
ARSILREFVCFPPPVSPRLNL
NT seq 2946 nt   +upstreamnt  +downstreamnt
atgttgcgaggagaggagcggccgccagagcgccgcggggcgggggagggagcggggcag
ccggagcttcgccagcctcactttgccggagagcgcggagaccacagcctgcctggggct
gtgagctgtgccacatacggacctcccggctcccagatggccaactcccagaacggccgg
aacccacgcaaaggacggatcctgggcttcatcgacgccattcaggatgctgtgggcccc
ccgaagcaggcggctgcggaccggaggactgtagagaagacctggaagctcatggacaaa
gtggtaagactgtgccaaaacccaaagcttcaactgaaaaacagcccgccttacattctt
gacattttaccagacacctaccaacatttgcgacttatactgagcaaatacgatgacaac
caaaaacttgcacaactgagtgagaatgagtactttaaaatctacattgatagtctcatg
aaaaaatcgaaacgggctataagactcttcaaagaagggaaggaaagaatgtatgaggag
cagtcacaggacaggagaaacttaactaagctgtccctcatcttcagccacatgctagca
gaaatcaaggctatttttccaaatggccaattccagggtgataacttccgtatcaccaaa
gcagatgctgcagatttctggaggaagttctttggagacaaaactatagtgccatggaaa
gtgttcaggcagtgccttcatgaagttcatcagataagctctggtttggaagcaatggct
cttaaatctactattgacttgacctgcaatgactacatttcaatttttgagtttgatatc
ttcactaggttatttcagccatggggttcaatcttaaggaattggaacttcttagctgtg
acacatcctggatatatggcgttcctgacatatgatgaagtgaaagcaagattgcagaag
tacagcacaaagcctgggagctacattttcagactgagttgcactcgcctggggcagtgg
gccattgggtatgtgactggtgatggaaacatactacagaccatacctcacaataagcct
ctgtttcaagctttgattgatggcagtcgggaaggattttatctcttcccagatggacga
agttacaatcctgatctgacaggattatgtgaacctacaccacatgatcacataaaggtc
acacaagagcagtatgaattgtactgtgaaatgggttccacttttcagctgtgtaaaatc
tgtgcagagaatgacaaggatgtaaagattgagccttgcggacatctcatgtgcacctct
tgtcttacagcatggcaggaatctgatggccaaggctgtcccttctgtcgctgtgaaatc
aaaggaactgaaccgattattgtggatccatttgatccaagagatgaaaactccagatgt
tgcagtattatcgatagctttagtatgcccatgttggacttggatgacgatgatgatagg
gaggagtctttgatgatgaaccgattggcttcagtccgaaagtgcaatgagaggcagaat
tcaccggtaacttctccaggatcttcccctctttcacaaagaagaaaaccacttccagac
cccctgcaaatcccacatcttagtcttccacctgtacctcctcgtctggatcttattcag
aagggagtggcacggtctccttgtgccagcccaactggatcaccaaagtcttctccttgt
atggtgaggaaacaagacaaacctttgccagcaccaccaccgcccttgcgtgatcctccg
ccacccccaccagagcgacctcctccaattccaccagacaacaggataagcagacactcg
catcatccagaaagcgtgccttccagagaccagccaatgccccttgaaggctggtgtccc
agagatgtgtttgggacaagtcagttagtaggatctcgaacaggaagtgacacttctccc
aaaccaggactgactgcagtttcaaacataaatggaaggcacaaccgcataagttctgag
caaggatttatgagaaaacacagacgtcacgaattgcctgtggaaggtgccaaggtattt
tcaaacggtcatctgataaatgaagaatatgatgtccctccacggctttcacctcctctt
ccaggtgcctccaccatcccgagtataaagtgccctgtttcctcagcaaattctctgtct
gataaatcaagggatcatacagatgatgatgatgaatacaaagttcctccttcacattct
ataatactgagctctcaaccacctcattgtcataatataaaagctgttgctcgggtttgt
gagaatggtcaatgtgctggagtaacaaatggaacacacagtgctacttctgatgtgaag
aaatcaaaacatccagagttaggtgaagatgcatttgatagctcacctccttcactacca
ccaccaccaccaccacctgctagacacagcatcactgagcacacgaaaccgtctggctca
ggaagtcgacctccttcaggacatgaactgttccttcatcctgatcctcattttgatcca
atgactggtcatgttcccttgccacctgttcgtagagtaactggagaaaatgtcaaaaca
aataggacatctcaagactatgatcagcttcctccctcttcagatggttcacaagcacca
gccaggccccctaaaccacttcctcggaggactgcaccagaaatacaccacaggaaagca
ttcaattctgacagttccacggaaaatgtggatgcaaaaattgcaaaactcatgggagaa
ggctattcctttgaagaagtcaagagggcacttgaaattgcccagaataatgttgacgtg
gctcgtagtattttacgagagtttgtctgttttcctccaccagtctccccacgtctcaat
ctatag

DBGET integrated database retrieval system