KEGG   Gallus gallus (chicken): 418438
Entry
418438            CDS       T01006                                 

Gene name
DCAF6
Definition
(RefSeq) DDB1- and CUL4-associated factor 6
  KO
K11795  DDB1- and CUL4-associated factor 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    418438 (DCAF6)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     418438 (DCAF6)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like
Other DBs
NCBI-GeneID: 418438
NCBI-ProteinID: XP_025007739
CGNC: 11504
Ensembl: ENSGALG00000015435
Position
1
AA seq 929 aa
MSRGRCPHLLWDVRKRSLGLEEPGLLRRHYLGRREFIQRLKLEATLNVHDGCVNTICWND
TGEYILSGSDDTNLVITNPYSRKVLTTIRSGHRANIFSAKFLPCTNDKQIVSCSGDGVIF
YTNVEQDAETNRQCQYTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKED
CKDDILINCRRAATSVAICPPIPYYLAVGCSDSSVRIYDRRMLGTRATGNYAGRGTIGMV
ARFVPPHLNNKSCRVTSLCYSEDGQEILVSYSSDYIYLFDPKDDTARELKVPSSEERREE
LRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLSRWFEEASEVAQ
SNRGRGRSRSRGGTNRTDASTTNNVPPSTESETAMEVDGSEQLPSSSSSTMSAQAPSTSS
STGSPPSTSLLSSPDNEQRPSLGASSQPVLHQSELMGPELAIIRRGLQRLRLKKAEQQRQ
RELAEGSAPQSSSDQSSSKGSSQDPQTSDSPSSVVNKQLGSMSLDEQQESDKPRTGTGEP
VLSLHYSTEGTTTSTIKLDFTDEWSSTNSSSRGSGSHCKTEGQEDSLKTKTSEESGPEDE
ETSKIQHYFCNGVPAESHKEDTTVPDKPVTEHPGIQPEENDSSVETVSRTAEEEASSEKS
ANQEISSQQSAESTANLLSANDEPQPHPESSGLATPEDCSTRTSALQETDDSDDDPVLIP
GARYRGGPGHRYNIRGTAIGDRIMRRSAVARIQELFRRRKERKEMEELETLNIRRPLIKM
VYKGHRNSRTMIKEANFWGSNFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPHP
FDPILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRML
ASLNHIRADRLEGDRSEGSGQENENEDEE
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgtcccggggccgctgcccccacctgctgtgggacgtgaggaagcggagcctggggctg
gaggagcccggcctgctgcggcggcactacctgggaagaagagaatttatccaaagatta
aaacttgaagcaaccttgaatgtgcatgatggatgtgtgaatacaatttgctggaatgat
acaggagaatatattttatctggttctgatgacaccaatctggttattaccaatccttac
agcagaaaggttttaacaaccattcgctcaggacaccgggctaatatttttagtgcaaaa
ttcctaccgtgcaccaatgacaaacagattgtatcttgttccggtgatggggtcatcttt
tatactaatgttgaacaggacgcggagaccaacagacaatgccagtatacgtgccactac
ggaaccacctatgagattatgacagtaccaaatgatccctatactttcctctcttgtggt
gaagatggcactgtacgatggtttgatactcgaatcaaaacaagttgcacaaaggaagat
tgtaaagatgatattttaataaactgtcgtcgtgctgccacttctgttgctatctgtcca
ccaatcccgtactatcttgctgtgggttgttctgatagctcagtaagaatatatgatcgg
cgaatgcttggtacaagagcaacagggaattatgccggtaggggcactattggaatggtg
gcacgttttgttcctcctcatctcaataacaaatcttgccgagtaacgtctctatgttat
agtgaagatggtcaagagatccttgttagctactcttcagattacatatacttgtttgat
cctaaggatgatacagcacgagagcttaaagttccttcctctgaggagagacgagaagag
ttacggcaacctcctgttaaacgtttgcggctaagaggggattggtcagatactggccca
agagcaaggcctgagagtgaacgggagagagatggcgaacagagtcctaatgtctctcta
atgcagaggatgtcagacatgctgtcaagatggtttgaagaagctagtgaagttgcacaa
agtaatcgaggacgaggaagatcacggtccagaggtgggactaatcggacagatgcttct
actactaataatgtgccacccagtacagaatcagaaactgcgatggaagtagatggttct
gaacaacttccatcgtcgtcatcttctacaatgtcagcccaagctccttcaacatcgtct
tcaacaggaagtcccccttcaacttcattattgtcctctcctgataatgaacaaaggcct
tctttgggggcctcatctcaacctgtgctccatcagtctgagttaatgggacccgagtta
gctataatccgtaggggtctgcagcgactgaggcttaagaaggcagaacaacagagacag
cgagagctagctgagggttctgcaccacagtcctcctctgatcagtcatcctctaagggc
tcctcacaggaccctcagacatcagattctccttcttctgtggttaacaaacagcttgga
tccatgtcacttgatgagcaacaggagagcgataagccacgaacaggaacaggtgaacca
gttttaagtttgcattacagtacagaaggaacaactacaagcacaataaaactggacttc
actgatgagtggagcagcacaaattcaagctctagagggagtgggagtcattgcaaaact
gaaggccaagaagattccttaaaaacaaaaacgtcagaagagtcaggacctgaagatgaa
gaaacaagtaagattcagcattacttctgtaatggagttcctgctgaatctcacaaggaa
gacacaactgtacctgataaacctgttactgagcatcctggaatccaaccagaagaaaac
gattccagtgttgaaactgtctccagaactgcagaggaagaagcttctagtgaaaaaagt
gcaaatcaagaaatttcaagtcagcaaagtgctgaatccactgccaacttgcttagtgca
aacgatgaacctcagccacacccagaatcctcagggcttgcaactccagaagattgttct
accagaacctcagctctccaagaaactgatgacagtgatgatgatcctgttctgatccca
ggggcaaggtatcgaggaggaccaggacacagatataatatcagaggaacagcgataggt
gatagaataatgagacgatctgctgttgcccgcattcaggagctcttcagaaggaggaaa
gaaaggaaagaaatggaagagttggagactttgaacattagacgtcctttaataaagatg
gtttataaaggtcatcggaactcccgaacaatgataaaggaagccaatttttggggatct
aactttgtcatgagtggttcagactgtggccatatttttatatgggatcgccatactgct
gaacatctcatgctgctggaagctgataatcatgtggtaaactgtcttcagcctcatcca
tttgacccaattctggcctcttcgggaattgactatgatataaaaatctggtcaccgttg
gaagaatccaggatttttaacagaaaacttgcagatgaggttataacacgtaatgagtta
atgctggaagaaaccagaaacactattactgttccagcatctttcatgttacgaatgttg
gcatctttgaatcacataagagcagaccgattggaaggtgacagatcagaaggatctggt
caggagaatgaaaatgaagatgaagaataa

DBGET integrated database retrieval system