KEGG   Gallus gallus (chicken): 418461
Entry
418461            CDS       T01006                                 

Gene name
CHMP2B
Definition
(RefSeq) charged multivesicular body protein 2b
  KO
K12192  charged multivesicular body protein 2B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
gga04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    418461 (CHMP2B)
  09143 Cell growth and death
   04217 Necroptosis
    418461 (CHMP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    418461 (CHMP2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    418461 (CHMP2B)
Membrane trafficking [BR:gga04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    418461 (CHMP2B)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   418461 (CHMP2B)
SSDB
Motif
Pfam: Snf7 DnaJ-X DUF3375
Other DBs
NCBI-GeneID: 418461
NCBI-ProteinID: NP_001025963
CGNC: 11553
Ensembl: ENSGALG00000015496
UniProt: Q5F3A2
Position
1
AA seq 214 aa
MASLFKKKTVDDIIKEQNRELRGTQRTITRDRAALEKQERQLELEIKKMAKTGNKEACKV
LAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQK
TLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDEEEESQDIVNQVLDEIGIEISGKMAK
APSAARGLPSASTSKASTISDEEIERQLKALGVD
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcttcgctttttaagaagaagactgtggacgatataataaaggagcaaaaccgagag
ttaagaggtacacagaggactataaccagagatagagcagcacttgaaaaacaggaaaga
cagctggaattggagataaagaaaatggctaagactggtaataaggaagcctgcaaagtg
ctagcaaaacagcttgtacaactgcggaaacagaagaatcgaacgtacgctgttagctct
aaagtcacttctatgtcaactcaaacaaaggtcatgaactctcagatgaagatggctgga
gctatgtcaactacagcaaaaacaatgcaagcagttaataagaaaatggatccacaaaag
acactacaaactatgcagaatttccagaaggaaaatatgaagatggaaatgactgaagaa
atgattaacgatactctagatgatatttttgatgcttctgatgaagaggaggaaagccag
gatattgttaaccaagtgcttgatgagataggaattgaaatctctggaaagatggccaaa
gctccatctgctgccagaggtctaccatctgcatcaacatcaaaagcttctaccatatca
gatgaagagattgaacggcaactcaaagctctgggagttgattag

DBGET integrated database retrieval system