KEGG   Gallus gallus (chicken): 418476
Entry
418476            CDS       T01006                                 

Gene name
JAM2
Definition
(RefSeq) junctional adhesion molecule B precursor
  KO
K06735  junctional adhesion molecule 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    418476 (JAM2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    418476 (JAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    418476 (JAM2)
CD molecules [BR:gga04090]
 Proteins
  418476 (JAM2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_C17orf99 Ig_6 C2-set_2 DUF3377
Other DBs
NCBI-GeneID: 418476
NCBI-ProteinID: NP_001006257
CGNC: 11746
Ensembl: ENSGALG00000015746
UniProt: Q5ZJD1
Position
1
AA seq 243 aa
MASRRLRLLLLGYLGVFCYHKVTGIAIETDNKNVKAEEFKEAILSCKHKFSKGMSLRIEW
KKIQSQEVSFVYYNGEFTVPPTTPICVVPNSAMTGTVVELSCKEAEGSPPSEYQWYKNGV
ALLEKTGTGSARTANITYTMNKKSGTLIFNTVSKNDTGEYFCVASNGIGLPQKCSMKRMQ
VDDLNVSGIIAAVVIVALVMALCGLGVLYAQKKGYFTKESSSQKSNSQSTSEKDFKHTKS
FVI
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcgagccgccgcctccgcctgctgctcctcgggtacttgggggtcttctgctatcat
aaggtgactggaattgctattgaaacagataataaaaatgtaaaagcagaagagtttaaa
gaggctattcttagttgcaagcacaaattttcaaaagggatgagtctaagaatagaatgg
aagaaaatccagtcccaagaagtttcatttgtttactacaatggtgaatttacagttcct
cccactactccaatatgtgtggtacccaactctgcaatgacgggaacagtagtggagctg
agctgtaaggaagctgaggggtctcctccatccgagtaccagtggtacaagaatggcgtt
gccttactggaaaagacaggaacaggcagtgctagaacagccaacataacttacaccatg
aataaaaagtctggcactctgatatttaacactgtttcaaagaacgacactggagagtat
ttctgtgtagcctcaaatgggattggattacctcagaaatgctccatgaagcgaatgcaa
gttgatgaccttaacgtaagcggtatcatcgctgctgtagtaattgtggctctggtaatg
gcactgtgtggccttggagtactttatgctcaaaaaaaagggtattttacaaaggaaagc
tcttcccagaagtccaactctcaatctacaagtgaaaaggatttcaagcacaccaaatcc
tttgttatctag

DBGET integrated database retrieval system