KEGG   Gallus gallus (chicken): 418478
Entry
418478            CDS       T01006                                 

Gene name
GABPA
Definition
(RefSeq) GA-binding protein alpha chain
  KO
K09441  GA-binding protein transcription factor, alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    418478 (GABPA)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    418478 (GABPA)
SSDB
Motif
Pfam: Ets GABP-alpha SAM_PNT AAA_25 Syntaxin-18_N
Other DBs
NCBI-GeneID: 418478
NCBI-ProteinID: NP_001007859
CGNC: 11756
Ensembl: ENSGALG00000015763
UniProt: Q5ZJ46
Position
1
AA seq 455 aa
MTKREAEELIEIEIDGNEKQECTEESIVEQTYTTAEFVNQAIDINEPIGNLKKLLEPRLL
CSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVVSRQGTDPKLNILEIVKPVETV
EVVIDPDAHHSEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEDYRKEQERL
GIPYDPVQWSTDQVLHWVVWVMKEFSMSDIDLNALSIPGRELCSLSQEDFFQRVPRGEIL
WSHLELLRKYVLASQEHSGEIATVTIDQPVHIIPASVQPATPTTIKVINSSAKAAKVQRA
PRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQK
WGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVR
ECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgactaagagagaagcagaggagttgatagaaatagaaattgatggaaatgagaagcag
gaatgtactgaagaaagcatcgttgagcaaacctacaccacagcagaatttgtgaatcaa
gctattgacatcaatgaaccaattggaaatcttaagaaattgctggaacccagactgctg
tgttccttggatgcacatgaaatttgtctgcaagatatccagctggacccagatcgaagc
ctttttgatcaaggagtgaaaacagatggaacagtacagctcagtgtacaagtagtatct
aggcaagggacagaccccaagttaaatatccttgaaatcgtgaagcctgtggaaactgtg
gaggtagtgattgatccagatgctcatcactcagaggctgaagctcaccttgttgaggaa
gctcaagtgataaccttagatggaacaaaacacattacaaccatttcagatgagacctct
gaacaggtgacacgatgggctgcagcgttggaagactacagaaaggagcaggagcgcctt
ggaataccctatgaccctgtgcagtggtcaacagaccaagtgctccactgggtggtgtgg
gttatgaaggagttcagcatgtcagacattgaccttaatgcactcagcattcctgggcgg
gaactctgcagcctctctcaagaagacttcttccagcgagtcccacgtggggagattctg
tggagtcacttggagcttcttcgaaagtacgtgttggctagccaagaacattctggagaa
atagcaactgttactattgatcagcctgtgcacattattccagcatccgtacagcctgct
accccaaccaccattaaagtaataaacagcagtgcaaaggcagctaaagtacagagagct
ccaaggatctcaggcgaagatagaagttcccctgggaacagaacaggaaacaatggccag
atccaattgtggcagtttctattagaacttctcactgacaaagacgctcgggactgtatt
tcttgggttggtgatgaaggagagtttaaattgaatcaacccgaactggttgcacaaaaa
tgggggcagcgcaaaaacaagcccaccatgaactatgaaaagcttagtcgggctttgaga
tactattatgatggagatatgatatgcaaagtgcaaggcaagaggtttgtctacaaattt
gtgtgtgacttgaaaactctcattggatacagcgcagcagagctgaatcggttggtcaga
gaatgtgagcaaaagaaactggccaagatgcagcttcatggcattgcgcagccagttaca
gcagtagcactagctactgcatccctgcaaacagagaaagataattaa

DBGET integrated database retrieval system