KEGG   Gallus gallus (chicken): 418488
Entry
418488            CDS       T01006                                 

Gene name
BACH1
Definition
(RefSeq) transcription regulator protein BACH1
  KO
K09042  transcription regulator BACH
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    418488 (BACH1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    418488 (BACH1)
SSDB
Motif
Pfam: BTB bZIP_Maf bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 418488
NCBI-ProteinID: XP_004938434
CGNC: 11810
Ensembl: ENSGALG00000015828
Position
1
AA seq 765 aa
MSLSEKNSVVFAYESSVHSTNVLLSLDDQRKQDILCDVTILVEDQRFRAHKAVLAACSSY
FLSRIVGQLDADLIITLPEEVTLKGFSPLLQFAYTAKLILNKDNVSEVCKCAEFLGVRNI
EESCFQFLKFKFLDCKSDQECPRKKCCTQHCRKVNPKISSVDDGDLEIDDEAEELIEKEY
IQTSHTKLCKDDENAKASPALQDNTNPTSDPMHLEKGHVSSSSSQCPKYRKFQKAFGNDK
VHTSDSSSSTKDVQVPPTVTSIEKEIPDNDSTPKAQECVPMQLVSQCEEAQVKMEEGEED
IEKKEESKRDSVTESISCPVEKMDVAAFPQNAAAPHGLNSVSFLRTCEQYGNLNFSSMQS
TTILSEKTATGTGAESDKIESHDNATLKVDLCAREAINITSTGDRSSVEREVAEHLAKGF
WSDIYSTEACQIHLPSAVPKERLEPAYSGKKSECPWLGIRISESPEPCSQRTFTTLSSVK
CPFISNLSTEGCSNSSEISSGDYVQGQQQEQCPYNYVISLGEDSETDTEGDSESCSAREQ
ECEVKLPFNAQRIISLSRNDFQSFLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLD
CIQNLESEIEKLQNEKENLLKERNLILSTLGETKQNLTGLCQQVCKEAALSNEQIQILAK
YSSSDCPLYFSFPERERTAPSEGELTAPTTAELVDGLLSVTPTEEQSSCYQRVKGVCDAT
YDQVQELHPVPVRTLEKTSLVEQCGQSGAITDFCQQMTDKCTTDE
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgtctctaagtgagaagaacagcgtggtttttgcatacgagtcttcagtacacagtacc
aatgtacttctcagtctcgatgatcagagaaagcaagatattctttgtgatgtcactatt
ttagtggaagaccagcgatttcgggctcacaaagctgtgcttgcagcttgcagtagttac
ttcctttcaagaattgtgggccagttggatgctgatcttatcatcactttaccagaagag
gtaacacttaaaggatttagtcccttgcttcagtttgcatacacagctaagcttatttta
aataaagacaacgtgtctgaagtttgcaagtgtgctgaattcttgggcgtacggaacatt
gaagagtcttgctttcagtttctcaaattcaaatttttggactgtaaatcagatcaagag
tgtcctaggaagaaatgctgcacgcagcattgcaggaaagtaaaccctaaaattagcagc
gtggatgatggagacttagaaatagatgatgaagcagaagaacttatagaaaaagagtat
attcaaacctctcacacaaagctctgtaaagatgatgaaaatgctaaagcatcacctgcc
cttcaagataataccaacccaacctcagatcctatgcatttagaaaaaggccatgtttcc
agctcatcttcccagtgccccaagtataggaaattccagaaagctttcggaaatgacaaa
gttcatacttcagattccagttccagtactaaagacgttcaggtgccaccaactgtaact
tctatcgagaaagaaatacctgataatgacagcacaccaaaagctcaggagtgtgttcct
atgcagctggtctcacagtgtgaagaggctcaggtgaaaatggaagaaggggaggaagac
atcgagaaaaaagaagaatcaaagagagattctgtgactgaaagcatctcgtgtcctgtg
gagaagatggatgttgctgctttccctcaaaacgctgctgcgcctcatggacttaattcc
gtgtcttttttacgtacttgtgagcaatatggtaacttaaatttcagtagtatgcaaagc
accacaatcttatctgaaaaaactgcaacaggtactggagctgaaagtgacaaaatcgaa
agtcacgacaatgcaactttaaaggttgatttgtgtgctagggaagccattaacattaca
tcaactggtgatagaagcagtgtggagagagaggtagcagagcatttagcaaaagggttc
tggagcgatatttacagtacagaagcctgtcaaatccacttgccatctgcagtgccaaaa
gaacgcttggagcctgcatattcggggaagaaatcagagtgtccatggctgggtatcagg
atcagtgaaagtcctgagccttgctctcaaagaacttttacgacattgagttctgtcaag
tgccccttcataagcaatctcagtactgaaggatgctccaacagctctgaaataagcagt
ggagattatgttcaagggcagcagcaagaacagtgtccctataattatgtgataagtttg
ggggaggattcagaaaccgataccgagggagacagtgaatcctgttcagctagagaacag
gaatgtgaggtaaaactgccatttaatgctcaaaggattatctccctttccagaaatgac
ttccagtcatttctgaagatgcataaattaacccctgagcagttggactgtatccatgat
atccgcagacgaagtaagaatagaattgcagcgcagcgatgtcgtaagagaaaacttgac
tgcatacaaaaccttgaatccgaaattgagaaactgcaaaatgagaaagaaaacttgctg
aaggagagaaacctcattttgtcaactctgggcgagacaaagcagaatctgaccggtctt
tgccagcaggtgtgtaaggaagcagccttgagtaatgagcaaatacaaatacttgcaaaa
tattcttcctcagattgtccactttacttttcattcccggagagagaacgaacagctcca
tctgagggcgagctcacagcaccaacgactgcagagttagtagatggtcttttgagtgtt
acacctacagaggagcagagttcttgttatcagcgtgtgaaaggtgtgtgtgatgcaaca
tatgatcaagtacaagaactacatccagttcctgtaagaacattggaaaaaacttcactt
gtggaacagtgtggacagagtggtgctatcacagacttctgtcagcaaatgactgataaa
tgcactacagatgagtaa

DBGET integrated database retrieval system