KEGG   Gallus gallus (chicken): 418505
Entry
418505            CDS       T01006                                 

Gene name
CRYZL1
Definition
(RefSeq) quinone oxidoreductase-like protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Other DBs
NCBI-GeneID: 418505
NCBI-ProteinID: XP_004934579
CGNC: 11940
Ensembl: ENSGALG00000029670
Position
1
AA seq 365 aa
MLAVCEVTMKALYCQQNSSGEEMTFIFQERENLPPTGDNDVKVQVRACALSWIDTKLLSE
VKLEKELLPVGREISGVVLEVGRKVSFFQPDDEVAGILPLDSEESGLCEVVLVHEHYLVH
KPEKVCWVEAAGTVRDGVRAYTALHYLSQVSPGKTVLVMDGASPFGTIAIQLAQHRGAKV
ISTAYSLEDKQYLERLRPAVEGMRQPLVTRVIDVSNGKIDVAESCLEETGGLGVDIVVDA
GVKLYSAEDESTSKSQLLPHKHDIITLLGVGGNWITTERNLQLDPPDSHSLFLKGATVSF
LNEEIWNLSNIEQGKYLCILEDIMEKLSSSVFRPQLDEPIPLYEAKVSMEIVQKNQARKR
QVIQF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcttgctgtgtgtgaggtcaccatgaaggccttgtattgtcagcagaattcatccgga
gaggaaatgacctttatcttccaggaaagggaaaaccttcctcctacaggagacaatgat
gtgaaagttcaagttagagcctgcgctctcagctggatagacacaaagctcctgtcagaa
gtgaaattggaaaaggagcttctgcctgttggtcgagaaatttctggagttgtattggaa
gttgggagaaaggtgtccttctttcagcctgatgatgaagtagcaggaattttgcctctg
gattctgaagagtctggcctttgtgaagttgttctagttcatgagcattatttggttcat
aaaccagaaaaagtttgttgggtggaagcagcggggactgttcgtgatggtgtccgagca
tacacagctttacactacctttcacaagtctctcctggaaaaactgtccttgtcatggat
ggagcgagtccatttggtacaatagctattcagttagcacagcatagaggagctaaagta
atatctactgcctacagtcttgaagataagcagtacctggagaggcttagacctgctgtg
gaaggtatgcggcagcctttagtgactcgggtgatcgatgtgtcaaatggaaagatagac
gtggcagaaagctgcttggaagaaacaggtggcttaggagtggatattgttgtagatgct
ggagtaaaattatatagtgctgaagatgaatcaacttcaaaatcacagttactgcctcat
aagcatgatatcatcactcttcttggtgttggaggaaactggataacaacagagagaaat
cttcagctggatcctccagacagtcattccttgtttcttaaaggagccacagtctccttt
ctgaacgaggagatatggaacttgtccaatatagagcaggggaagtatctctgcatctta
gaagatataatggagaaattatcaagtagtgttttcaggcctcagctggatgaaccgatc
cccttgtatgaagccaaagtttctatggaaatagttcagaagaatcaagcaagaaaaaga
caagtcattcagttctaa

DBGET integrated database retrieval system