KEGG   Gallus gallus (chicken): 418545Help
Entry
418545            CDS       T01006                                 

Gene name
CBS
Definition
(RefSeq) cystathionine beta-synthase isoform X1
  KO
K01697  cystathionine beta-synthase [EC:4.2.1.22]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00260  Glycine, serine and threonine metabolism
gga00270  Cysteine and methionine metabolism
gga01100  Metabolic pathways
gga01230  Biosynthesis of amino acids
Module
gga_M00035  Methionine degradation
gga_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    418545 (CBS)
   00270 Cysteine and methionine metabolism
    418545 (CBS)
Enzymes [BR:gga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     418545 (CBS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP CBS DUF1414
Motif
Other DBs
NCBI-GeneID: 418545
NCBI-ProteinID: XP_015156364
CGNC: 12106
Ensembl: ENSGALG00000016196
Position
1
AA seq 577 aa AA seqDB search
MEKLMSEKPVPVSKDETLSLPSQAKPDTNSCPHASGKYFLPGGTDTEDCKTNDKERKWIR
PDTPSKCTWKLGKPISASPHRHMSLPEPPNILPNILNKVGNTPLVRINKIGKYFGLKCEL
LAKCEYFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRC
IIVMPEKMSMEKVDVLRALGAEIVRTPTTARFDSPESHVGVAWRLKNEIPNAHILDQYRN
ASNPLTHYDTTAEEILQQCEGKIDMLVATAGTGGTITGISRKLKEKCPGCKIIGVDPEGS
ILAQPDELNKTDKTMYEVEGIGYDFVPTVLDRSLVDQWYKSNDEESFALARMLIREEGLL
CGGSSGSAMSVAVKAAKELKEGQRCVVIFPDSIRNYMSKFLSDKWMIQKGFMTEEDLVKK
PWWWNVSVQELSLSAPLTVLPTVTCAKTVEILREKGFDQVPVVDESGVILGMVTLGNMLS
SLLAGKVQPSDEVSKVIYKQFKQADNQGSGGNVINLQDNLGRLSHILETDHFALVVHEQI
QYHTDGSSSKRQMVFGIVTAIDLLNFVTARERERKIN
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgatgtcagagaagcctgttccagtgtctaaggatgaaacgctttccctt
ccttcccaggccaagccagatacaaactcatgccctcatgcttctggcaaatacttcctc
cctggtgggacagacactgaggactgtaagactaacgacaaggaaaggaagtggatccgt
cctgatacacccagcaaatgcacgtggaagcttggaaaacccatctcagcatccccccat
cgtcatatgtccctgccagagcctccaaatatcctgcccaacatcctgaataaagttggc
aacacaccgttggtgcgaatcaacaagattgggaagtactttgggctgaagtgtgaactc
ttggcaaaatgcgagtacttcaatgcggggggcagcgtgaaagaccgcatcagcctgagg
atggtagaggatgctgagagagctgggatcttgaaacctggagacacaatcatagagcca
acctctggaaacacaggaattgggctggccttggctgcagcagtgaagggttaccgctgt
atcattgtgatgccagagaaaatgagtatggagaaggtggatgtcctgagagctctgggt
gctgagattgtgaggaccccaactactgccagatttgattctcctgaatctcacgtgggc
gtagcatggagactgaagaatgaaatccccaacgcacatatcttagaccagtaccgtaat
gccagcaatcccctgacacactatgacactacagctgaagagatcctgcaacagtgtgaa
gggaaaatagacatgctggtggctacagctggtacaggaggtaccatcactggcatctcc
agaaagctgaaggagaagtgtccaggttgcaaaatcataggtgttgatcctgaaggctcc
atccttgctcagccggatgaactgaacaagaccgacaagacgatgtatgaagtggaagga
attggatacgattttgtccccacagtgttggatagatctctggtggaccagtggtacaag
agcaatgatgaggagtcatttgctttagcacgcatgctaatccgagaggaaggactgctg
tgtggtggcagctcaggcagcgcaatgtctgtagctgtgaaggcagccaaagagctgaag
gagggtcagcgctgtgttgttatcttccctgactctatcaggaactacatgtccaagttc
ttgagtgacaaatggatgattcaaaaagggttcatgacagaagaagaccttgtcaaaaaa
ccttggtggtggaacgtcagtgttcaggagttaagcctctcagctcccctgactgtgctt
ccaactgttacctgtgccaagactgttgaaattctccgtgagaaggggttcgaccaggta
ccagttgttgatgaatctggggtgattttgggcatggttactctaggtaacatgctttct
tcactgcttgctggaaaagttcagccttcagatgaagtcagcaaagtcatctacaagcaa
ttcaagcaggcagataatcaaggatcaggtggaaatgtgattaacctgcaagacaacttg
gggagactctctcatatcctggaaacagaccactttgctctagtggttcacgaacaaatt
cagtatcacactgatggctcctccagtaagcggcaaatggtgtttggcattgttacagcc
attgacctgctcaactttgtgactgcgcgagaacgggaaagaaagatcaactaa

DBGET integrated database retrieval system