KEGG   Gallus gallus (chicken): 418549
Entry
418549            CDS       T01006                                 

Gene name
PDXK
Definition
(RefSeq) pyridoxal kinase isoform 1
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00750  Vitamin B6 metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    418549 (PDXK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     418549 (PDXK)
SSDB
Motif
Pfam: Phos_pyr_kin PfkB SRR1 HpcH_HpaI
Other DBs
NCBI-GeneID: 418549
NCBI-ProteinID: NP_001265013
CGNC: 12115
Ensembl: ENSGALG00000016205
Position
1
AA seq 314 aa
MEPERECRVLSIQSHVVRGYVGNKAATFPLQVLGFEVDTVNSVQFSNHTGYAHWKGQVLN
SDELHELYEGLKLNKVNQYDYVLTGYTRDTSFLAMVVDIVQELKQQNSNLVYVCDPVMGD
KWNGEGSMYVPKDLLPVYRDKVVPVADIITPNQFEAELLTGRKIYTEKDALEVMDMLHAM
GPETVVITSSDLQAPLGNDYLIALGSYRKTNADGTKITQRIRMESPKVDAAFVGTGDLFA
AMLLAWTHKHPNNLKVACEKTVSAMQHVLQRTIKSAKAQAGEGNKPNSANLELRMVQSKK
DIENPEIIVKATVL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggagccggagcgcgagtgtcgggtgctgtccatccagagccacgtcgtgcgcggctac
gtgggcaacaaggcggccacctttcccctgcaggttttgggattcgaagttgacacagtg
aactctgtccagttttcaaaccacacaggttatgcccactggaagggtcaagtgttaaat
tctgatgaacttcatgaactgtatgaaggacttaagctcaacaaggtcaaccaatatgat
tatgtactcacaggatatacaagggacacatcatttcttgcaatggtggtggatattgtc
caagagttgaagcaacagaattctaacctagtatatgtgtgtgatccagtgatgggagac
aaatggaatggagaaggctccatgtatgtgcctaaggatctcctcccagtctatagggac
aaagttgtgcccgttgctgatatcattactcctaaccagtttgaggctgagttacttact
gggaggaagatttacaccgaaaaagatgctttagaggtaatggatatgctccatgccatg
ggaccagagactgtggtgataaccagctcagatctacaggcaccgctaggaaacgactac
ctgattgctctgggaagctacaggaaaactaatgcagatggtaccaagataacgcagaga
attcgaatggaatctcctaaagtggatgctgcctttgttggaacgggagacttgtttgct
gctatgcttttggcatggacacataaacatccaaacaatctgaaggtggcatgtgaaaag
actgtgtcagccatgcaacatgttctgcaaaggaccattaagagtgcaaaagcacaagct
ggagaaggaaacaaaccaaactcagccaatctggaactgagaatggtccaaagcaaaaag
gacatagaaaacccagagatcatagtgaaagctactgtgttataa

DBGET integrated database retrieval system