KEGG   Gallus gallus (chicken): 418685
Entry
418685            CDS       T01006                                 

Gene name
ATP10A
Definition
(RefSeq) probable phospholipid-transporting ATPase VA
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    418685 (ATP10A)
Enzymes [BR:gga01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     418685 (ATP10A)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase Cation_ATPase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 418685
NCBI-ProteinID: XP_416881
CGNC: 12557
Ensembl: ENSGALG00000043118
UniProt: A0A1D5PHS1
Position
1
AA seq 1518 aa
MSRGAAGGEGEPQVRPEGKERQRKRRRRKKKESKTRLVRSSLLPPEAEAEKSKRPALASN
RLKTTKYTALSFLPKNLFEQFHRLANVYFVFIALLNFVPAVNAFQPELALAPVLFILAVT
AIKDLWEDYSRYRSDQEINHMECLVYCRNEKKYISRYWKEVKIGDFVQLRCNEIIPADIL
LLSSSDPDGLCHIETANLDGETNLKQRQVVRRFLELDSEFDPLKFTSVIECENPNNDLSR
FRGSIVHKSGKKDGLFKENLLLRGCTIRNTEEVVGIVIYAGHETKALLNNNGPRYKRSKL
ERQMNADVLWCILILLIMCLFSAIGHGLWVWQYGEKKKPVFDVPGPDGKYLSPVLASVYL
FLTAIIVFQVMIPISLYVSIEIVKICQVYFIHQDKDLYDEETDSQLQCRALNITEDLGQV
QFIFSDKTGTLTENKMVFRRCTVSGIEYSHDDNAKRLAMYQEPDSEEEEAAPKGGTLSQR
DSICSHQSIKVIHRSQSTKTHRRTGSRAEAKRASILSKHTAFSSPMEKDITPDPHLFEKV
NECAKHLEIMRGHEQPLSHLSPELCDIFDFFIALTICNTVVVTAPNQPRQKVRDRFELKS
PVKTIEDFIRRLTPSRLTSGSNSSSSSSLATNKSMHRFGLSILSSTSTESTLLKLEEKLA
YSAQMNNNGYSSQQGRMAVGNGPEEGELRYEAESPDEAALVYAARAYNCSLVGRLSDQVS
VELPHLGTLNFEVLHTLGFDSIRKRMSVVVRHPLTDEINVYTKGADSVIMDLLLPCSSGD
PRGKHQKKIQTKTQNYLNLYAVDGLRTLCIAKRVLSKEEYACWLKSHLEAESSIENREEL
LFQSALQIEKNLHLLGATGIEDRLQDGVPETIASLRKAGLQIWVLTGDKQETAVNIAYAC
KLLDHDEEIITLNAESPETCAVLLEQCLQCVESKFSNNTIDEATGNMTVGFTPLYPPSSP
VLSSLGLVIDGRTLAYALEPTLEDKFLALAKRCRSVLCCRSTPLQKSMVVKLVRDKLKAM
TLAIGDGANDVSMIQVADVGVGISGQEGMQAVMASDFAIPRFRHLEKLLLVHGHWCYSRL
ANMVLYFFYKNAMFVALLFWYQFYCGFSGSSMVDQWYLIFFNLLFSSLPQLITGVLDKDV
PAEVLLSVPQLYKSGQNMEEYQPHMFWMNMIDAMYQSLVCFFIPYFTYYDSEVDIFSWGT
PITTTALFTIILHLAIETKTWTFLHWSSCIFSILLFFFVALVYNASCPVCHPPSNPYWTM
ERLMGDPMFYFTCIISPVVALLPRFLYRTLQGTLFPTQLQLGRQLSKLSPEIRTQLLTKL
NVKKGPIHQTQSSANSFSPNLVSNASHSFKPYNQNTPSPTSPTNESLFQEHTKAERATDR
IVSASPQCAPFYEESSLPSSAHSQERSVGFHEVTHSASEMELSPMGTTFPWSSAVDETDF
SLLKWITSTPLFSRFGTVLQVSSSSLQSETQDGKCVLGSSLQEDFKDLKEQSSNNFQDKM
KGTPADHWKSDNSESTFL
NT seq 4557 nt   +upstreamnt  +downstreamnt
atgtcccggggcgcggcggggggcgagggagaaccccaggtgcggcccgaggggaaggag
aggcagaggaagaggaggaggaggaagaagaaggagagcaagacgcggctggtgcgctcc
agcctgctaccacctgaggccgaggcggagaaatccaagcggcccgccctggccagcaac
cgtctcaagaccaccaagtacacggccctctcctttctgcctaagaacctctttgaacag
ttccaccgcctggccaatgtctacttcgtcttcatcgcgctgctcaacttcgtgccggcg
gtcaacgccttccagcctgagctggccctggcccccgtgctcttcatcctggcggtcacg
gccatcaaggacctgtgggaagactacagccgttaccgctccgaccaggagatcaaccac
atggagtgcctggtgtactgcaggaatgagaagaaatatataagcagatactggaaagaa
gtgaaaattggagactttgttcagcttcgctgtaatgagatcatacctgctgacatcttg
ctgctctcttcaagtgatcctgatgggctgtgccatatagaaacagctaacctggatggt
gaaactaacttaaaacaaagacaggtggtgaggaggtttttagagctggactcagaattt
gaccccttgaagttcaccagtgtcattgaatgtgagaatcctaacaacgacttaagtagg
tttcgaggttccattgtacataaaagtggaaaaaaggatggactgttcaaagaaaatctt
ttgttacgtggatgtactattagaaatacagaagaagttgtaggaattgtaatctatgca
gggcatgagaccaaagctttgttaaataataatggacctcgttacaaacgcagtaagctt
gaaaggcagatgaatgctgatgtcctttggtgtatccttatacttctcatcatgtgtctg
ttttctgccattggtcatggcctatgggtatggcaatacggtgagaagaagaaaccagtt
tttgatgttccaggacctgatggcaaatacttgtcccctgttctagcttcagtatattta
tttctgacagcaatcatagtttttcaggttatgattccaatttctttgtatgtttccatt
gaaatagttaaaatctgccaagtgtactttattcaccaagataaagatttatatgatgaa
gaaacagactctcagctgcagtgccgagctttaaatatcacagaagacttaggtcaggtg
cagtttatcttttcagacaagactgggacgcttactgaaaataagatggttttccgaaga
tgcacagtttctggaatagagtattcccacgatgataatgccaaacgcttagcgatgtac
caagaacctgattctgaagaagaggaagcagctccaaaaggaggaactttatcccagcgt
gacagtatctgcagccatcagagcatcaaagtaattcacagaagccagagcaccaaaacc
caccgccgcacgggaagcagagctgaagcaaaaagagcaagcatactgtcaaagcatact
gcgttcagtagcccaatggagaaggacatcacaccagatcctcacttgtttgaaaaggtg
aatgaatgtgcaaagcatctggagatcatgaggggccacgaacagccattatcccatctg
agtccagaactgtgtgatatttttgacttcttcattgctttgactatctgtaatactgtt
gtggttactgctccaaatcagccccgacagaaggttagagaccgatttgaactaaaatct
cctgtaaaaaccatagaagacttcatccgaagactcactccaagtcgcttgacctctgga
tctaacagcagcagttcatccagcctagctacaaacaaatcaatgcatagatttggttta
agtatcctttcatcgacatctactgagagcactttattaaaactggaagagaagctggca
tactctgcacagatgaataacaatggctacagctcccagcaaggcaggatggctgtaggg
aatgggcctgaggaaggagagctccgttatgaagcagagagtccagatgaagctgctctc
gtctatgcagcaagagcatataactgttctctggttggaaggctgtctgaccaggtatca
gtggagctacctcacctgggaacattaaactttgaagtattacatacattgggctttgat
tccatcaggaagaggatgtcagtagtggtcagacatcctctcacggatgaaataaatgtt
tacactaaaggagcagattcagttattatggatctccttctgccttgttcttcaggtgac
cctcggggcaaacatcaaaagaaaatccaaaccaaaacccagaattaccttaatctgtat
gctgtagatgggctgcgaaccctgtgtattgcaaaacgagttctgagcaaagaggagtat
gcttgttggttaaaaagtcatctggaagcagaatcttctattgagaatcgtgaagaactt
ctgtttcagtctgcactgcagatagagaagaatttgcatctgctaggtgccactggtatt
gaagaccgtttacaggatggtgttccagaaaccattgcaagcttgcgcaaagctgggttg
cagatttgggttcttactggagataagcaagaaactgctgttaatattgcatatgcctgc
aagctactagatcatgatgaggaaatcatcacattgaatgctgaatcaccagagacatgt
gctgtcttgctggagcagtgtctacaatgtgtagagtctaaattttcaaacaacacaata
gacgaagctactggaaacatgactgttgggttcacccctctctatccaccctcttcccct
gtgctttccagcttgggcctagtgattgatggaaggactctagcttatgccctggaacct
acattggaagataaatttcttgcactagctaagcggtgccgttcagttctgtgttgtcgc
tctactccactccaaaagagcatggtagtgaaactagtcagagacaaactcaaagcaatg
accttggcaataggtgatggtgctaatgatgtcagtatgatccaagttgcagatgttggc
gtggggatctctggtcaagaaggcatgcaggcagtaatggcaagcgactttgcaatccca
aggttccgacatttggagaagctcttgcttgttcatggtcactggtgttactcccgactt
gccaacatggtgctgtatttcttctacaaaaatgcaatgtttgtggcccttcttttctgg
taccagttctactgtgggttctccggctcatcgatggttgaccagtggtatctcatcttc
tttaatttgcttttctcttctcttccacaactgattactggtgtactcgataaggacgtg
ccagctgaagtgttactgtctgtacctcagctttataaaagcggacagaatatggaggag
tatcaaccacacatgttttggatgaacatgattgatgctatgtatcaaagcctcgtttgc
ttcttcatcccttattttacttactatgattcggaggtggatattttctcctggggaact
cccatcaccacaacagcacttttcaccatcattctacatttggctattgaaaccaaaact
tggactttcctccactggtcatcttgcatcttcagtatccttttatttttctttgtggct
ctggtttacaatgcttcctgcccagtatgccatcctccatccaatccctactggactatg
gaaagactgatgggagacccgatgttctacttcacttgcattatatcaccagtagttgca
ttgctgcccagatttctgtacagaacccttcagggaacactattcccaacgcagcttcag
cttggacgccagttgagtaaactatctccagagattcgcacccagcttctgaccaagttg
aatgtcaaaaaaggaccaatacatcagacgcaatcctctgcaaacagcttctcaccaaac
cttgtctcaaatgccagtcacagttttaagccttacaaccaaaacacgccttcgccaaca
tctccaacaaatgagtcacttttccaagagcacacaaaggcagaacgtgcaacagatcgg
attgtgtctgcctctccccagtgtgctccattttatgaggagagcagtctcccctcatca
gcacatagccaggaaaggtccgtgggatttcatgaagttactcacagcgcttcagagatg
gagttgtctcccatgggaacaactttcccatggagctcagcagtcgacgaaacagacttc
agtttgttgaagtggatcacatcaactccactgttcagtcgctttggaactgttttacag
gtgtcatcaagtagtttacaaagtgaaacacaagatgggaagtgtgtgctcggctcttcc
ttgcaggaggacttcaaagacttaaaagaacagagctcgaataacttccaggacaaaatg
aaagggaccccagctgaccattggaaaagtgacaattctgagtccacctttttatga

DBGET integrated database retrieval system