KEGG   Gallus gallus (chicken): 418710
Entry
418710            CDS       T01006                                 

Gene name
RPL31
Definition
(RefSeq) 60S ribosomal protein L31
  KO
K02910  large subunit ribosomal protein L31e
Organism
gga  Gallus gallus (chicken)
Pathway
gga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    418710 (RPL31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    418710 (RPL31)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    418710 (RPL31)
  Archaea
    418710 (RPL31)
SSDB
Motif
Pfam: Ribosomal_L31e Vsr
Other DBs
NCBI-GeneID: 418710
NCBI-ProteinID: NP_001264684
CGNC: 50833
Ensembl: ENSGALG00000016775
Position
1
AA seq 125 aa
MAPAKKGSEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTP
DVRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKGLQTV
NVDEN
NT seq 378 nt   +upstreamnt  +downstreamnt
atggctcccgcaaagaaaggcagcgagaagaagaaggggcgatctgccatcaacgaggtg
gtgaccagggagtacaccatcaacatccacaagcggatccatggagtgggcttcaagaag
cgggccccgcgtgctctcaaggagatccgtaaatttgcaatgaaagaaatgggtactcct
gacgttcgcattgacaccaggctgaacaaagcagtctgggcgaaaggaataaggaacgtt
ccttaccgtatccgtgtgcgtttgtccagaaagcgcaatgaggacgaagattccccaaac
aagctgtacacactggttacctacgtaccagtcacaacgttcaaaggtctacagacagtc
aacgtggatgaaaattaa

DBGET integrated database retrieval system