KEGG   Gallus gallus (chicken): 418712
Entry
418712            CDS       T01006                                 

Gene name
RNF149
Definition
(RefSeq) E3 ubiquitin-protein ligase RNF149
  KO
K15704  E3 ubiquitin-protein ligase RNF149 [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    418712 (RNF149)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     418712 (RNF149)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    418712 (RNF149)
SSDB
Motif
Pfam: zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-rbx1 zf-C3HC4 zf-RING_5 PA zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 zf-ANAPC11 CrgA PspB Zn_ribbon_17 zf-C3H2C3
Other DBs
NCBI-GeneID: 418712
NCBI-ProteinID: XP_015133283
CGNC: 12584
Ensembl: ENSGALG00000016779
UniProt: F1P4V3
Position
1
AA seq 404 aa
MVRRARLALVAAALVALGAPGGQGARALEWYTAWVSTSYVEPLSNRTVRGNTESGRYGDS
SPKESAQGLVGIPRGASPRHMEGCAADTDYDVPLPAGGRPAPDGDPPPWIALVARGGCTF
KDKITNAARKRATAVVIYNEARFGNSTVSMSHLGTGNTVVIMVGYPKGIEILEPVRRGIP
VRMTIGVGTRHVQEYISGQSVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQFGNQGHR
KETKKAIGQLQLHTVKRGDKGLDVDVENCAVCIENYKLKDTVRILPCKHIFHRTCIDPWL
LDHRTCPMCKLDVIKALGYWGDPEDALEVPIPESISGSVSVGSLSIALQEDDRNEVSELS
ASSTSESVLQCTSLKEDAGETTALLDVDVSNNRHGEHLSNGNSH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggtgcggcgcgcccggctggcgctggtggcggcggcgctggtggcgttgggagcgccg
ggcgggcagggagcccgggcgctggagtggtacacggcgtgggtgagcacgagctacgtg
gagccgctcagcaaccgcaccgtgcggggcaacacggagagcggccgctacggggacagc
tcgcccaaggagagcgcgcagggcctggtgggcatcccccgcggcgcctcgccccgccac
atggagggctgcgccgccgacaccgactacgacgtgccgctgcccgccggcggccgcccg
gcgcccgacggagacccgccgccctggatcgcgctggtggctcgcggcggctgcacgttc
aaggacaagatcaccaacgcggccaggaagcgggcgaccgccgtggtgatctacaacgag
gcccgcttcgggaacagcaccgtctccatgtcccacctcggaacaggaaatacagtggtg
ataatggttggctatccaaaaggaatagagatattggagccagtacgaagaggcattcca
gtaagaatgaccattggtgttggcacacgtcacgtgcaggaatatatcagtggtcagtcg
gttgtgtttgttgccatcgccttcatcaccatgatgattatatcgcttgcttggctgatc
ttttactatatacaacgtttcctgtatacaggatcacagtttggaaaccagggacatagg
aaagaaaccaagaaagcaatcggccagcttcaactgcatactgtgaaacgtggagacaag
ggtctagatgttgatgtggaaaactgtgctgtgtgtattgagaactataaactaaaagat
actgtccgaattctaccatgcaagcatatcttccatagaacgtgcattgacccttggctt
ttggatcaccgaacttgtccaatgtgtaaactagatgttatcaaagctttgggatactgg
ggggaccctgaagatgcactcgaagttccaatacctgaatcaataagtggcagtgtttca
gttggaagtctgagtattgctttacaagaagatgacagaaacgaagtaagcgaactgtca
gcttcctccaccagtgaatctgtattgcagtgcaccagtttaaaagaggatgcaggtgaa
accacagcattacttgatgttgatgtcagtaataaccggcatggagagcatctatctaat
ggaaattcccactga

DBGET integrated database retrieval system