KEGG   Gallus gallus (chicken): 418732Help
Entry
418732            CDS       T01006                                 

Gene name
SEPT10
Definition
(RefSeq) septin-10 isoform X1
  KO
K16940  septin 10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    418732 (SEPT10)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     418732 (SEPT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 AAA_16 ABC_tran GTP_EFTU AAA_22 RsgA_GTPase Roc AAA_23 AAA_29 RHD3 Dynamin_N AAA_7 Microtub_bd Ras G-alpha T2SSE IIGP AIG1 FtsK_SpoIIIE Atg14
Motif
Other DBs
NCBI-GeneID: 418732
NCBI-ProteinID: XP_015133401
CGNC: 50840
Ensembl: ENSGALG00000016811
UniProt: E1BV11
Position
1
AA seq 428 aa AA seqDB search
MAGAGQPKNDGLRSLSLSGHVGFDTLPDQLVNKSIKQGFCFNILCIGETGSGKSTLINCL
FNTSFDESMSTHFHPNVRLKAQRYELHESNVRLKLTVVSTVGFGDQINKEDSYQPIVDYI
DAQFEAYLQEELKIKRSIFNYHDTRIHVCLYIISPTGHSLKTLDLLTMKSLDSKVNIIPL
IGKADSISKTELQQFKRKLISELVSNGVRIYQFPTDDEAVSQINAVMNGHLPFAVVGSTE
EVKIGNKMVKARQYPWGTVQVENENHCDFVKLREMLICTNMEDLIEQTHACHYELYRRRR
LQEMGFRDIDPENKPVSLQEAYETKRREFYLELQRREEEMRQKFVQRVKEKEAVLKEAEQ
RIQAKFEHLMLMHQEEKQKLEKKRKALEEEIALFNMKKANAELLQTKPTVSTPVSLKRDK
DRKNSSFT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcggggcagccgaagaatgatggccttcgatccttatccttgtctggccat
gttggttttgatactttacctgatcagctggttaacaaatccatcaagcaaggcttctgc
ttcaacattctttgtatcggggaaactggatctgggaaatctaccttaataaactgtcta
tttaacaccagttttgatgaatccatgtcaactcattttcatccaaatgtaagacttaaa
gctcagagatacgaactccatgaaagcaatgttcgtttgaaactaaccgttgtgagtact
gtgggatttggtgaccagataaacaaagaagatagctatcagccaatagtggattacata
gatgcacaatttgaagcctacctccaagaagaactgaaaattaaacgttccatatttaac
taccatgatactcgcatccatgtgtgcctctacatcatttcacctacaggccattcccta
aagactctagatttgttaaccatgaaaagtctagacagcaaggtgaacattataccactt
ataggcaaagcagacagcatttctaaaacagaactgcagcaattcaagaggaaactcatt
agtgaattagttagcaatggtgtgcggatataccagtttccaactgacgatgaagccgtt
tctcaaattaatgctgtcatgaatgggcatttaccttttgctgtagtgggaagtacagaa
gaggtgaaaattggaaacaaaatggtgaaagctcgtcagtacccttggggcactgtacaa
gtggaaaatgagaaccactgtgactttgtgaagctccgtgagatgcttatttgcacaaat
atggaagatttaatagagcagactcacgcatgccattatgagctgtacaggcgccgcaga
ctgcaggagatgggcttcagagacattgaccctgagaacaagccagtaagtctacaggaa
gcctatgagacaaagaggcgcgagttctaccttgagctgcaacgaagagaggaggagatg
aggcagaaatttgtgcagagagtgaaggagaaagaagcagtattgaaagaagcagagcaa
cggatacaggctaagtttgaacatcttatgctaatgcatcaagaagagaaacagaaatta
gagaagaagcgaaaagctctagaggaagaaatagctctgtttaacatgaagaaagctaat
gctgaattactccaaacaaagccaacggtctctactcctgttagcttgaagagagacaag
gaccgcaaaaattccagctttacataa

DBGET integrated database retrieval system