KEGG   Gallus gallus (chicken): 418789
Entry
418789            CDS       T01006                                 

Gene name
DZIP1
Definition
(RefSeq) zinc finger protein DZIP1 isoform X1
  KO
K16470  zinc finger protein DZIP1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    418789 (DZIP1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    418789 (DZIP1)
SSDB
Motif
Pfam: Dzip-like_N Herpes_glycoH_C zf-C2H2_4
Other DBs
NCBI-GeneID: 418789
NCBI-ProteinID: XP_015130239
CGNC: 12679
Ensembl: ENSGALG00000016895
Position
1
AA seq 826 aa
MPFTERAYFPAGAAATGAGPFPAFQFRGRHEGPDWRRLSAVDVGRVWREGDVAALQEHLE
HVTFCSAERERCPHCQGPADPLLLKLLRLAQLCTEYLLHSQEYLSAQLGSLEEALRAAQA
QRDRLAEEVAQRTQEVKGLKEECRRRKKMISTQQMMLEARASYHQCQFCEKAFMNYSFLQ
GHMQRRHPEESQIAEQKRKAKTDKLQDEIEKLKEQLQLTKSQLEAEQQANVVRFSKECEQ
QKSKEEEILQSFHKWKEEEKAKLADEIEKVKDMFMKELKELSSRNSTLENQLLALQTSSM
QKSNLGTLKDSHEFMEEKPQSTQDYHKVVKLLEKQESKWTSRIQALRQDHETEKSLLLSQ
IEKLKSSVREDLNKNNTFYKRRIEELGERLQEQNDLIITQKKQIKELSTKSVASIKPYDT
NTAVERLEEPKSSLPVMYEQAPLVHMLEPIEELSEEEKEIEKDDLKTGRSNQHLINALKT
DPSLTKELRVVLEQALEEKLESLGIKAGVRGIPNDRLNKILRAIESAREHKLKQEPHIQR
IREYLERQVGFRIVERSTLSNRTVSSPYITSEGKQKFNQLGISSSTIPQKPVKRSLTAVR
PAEQRAAIAENTSTPKKLIGNEASKKTSSITTPPFSSEEEADDDDVKQLRVSRELLQKQS
KTSSSKISAFQMASDKSDVDGTEESETEETGTPVKTSKGTVIQKLTEQVGRSLSNHANKS
RPAGGIDVAQAFIKKEEVQEPKFTEADEDDWDISSIEEDYLLMKDNNGQKASIVQKNESN
ATSVVHAWGLPKKTVPKQEGPREVDNTSTLKSSLVTVTDWSDSSDI
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgcccttcacggagcgcgcctatttcccggcgggggcggccgcgaccggcgcggggccg
tttcccgccttccagttccgcgggcgccatgagggcccggactggcggcggctgagcgcc
gtggacgtgggccgggtgtggcgggagggcgacgtggcggccctgcaggaacacctggag
cacgtcaccttctgcagcgccgagcgggagcgctgtccccactgccagggccccgccgac
ccgctgctgctcaagctgctgcgcctggcccagctgtgcaccgagtacctgctgcactcg
caggaatacctgagcgcccagcttggcagcctggaagaggctctgcgtgcggcccaggcc
cagcgcgaccgcctggccgaggaggtggcccagcgcacccaggaggtcaaggggctgaaa
gaggagtgccggcgcaggaagaagatgatcagcacccagcagatgatgctggaggcccga
gccagctaccatcagtgtcagttctgtgaaaaggcttttatgaactattcctttttacaa
ggtcacatgcaaaggcgtcatccagaagaatctcagattgcagaacaaaagaggaaagcg
aagacagacaaactgcaggatgagattgagaaactgaaggagcagctgcagctaaccaaa
tcccagttagaagctgaacagcaagctaatgtggtccgattttccaaggaatgtgaacag
caaaaatcaaaagaagaagaaattctacaatcatttcataaatggaaagaagaagaaaaa
gccaaattggctgatgaaatagaaaaagtgaaagatatgtttatgaaagagcttaaggag
ttatcttcaagaaattcaacattagaaaatcaactgttagcattacaaacatccagtatg
cagaagtccaatttagggacactgaaagacagccacgaattcatggaagagaagcctcag
agtactcaggattatcacaaagtggttaaacttcttgaaaaacaggaaagtaaatggacg
tctagaatacaagcccttcgtcaagatcatgaaacagagaagtccctgctcctgtcacag
attgagaagcttaaatcgtcagtgagagaagacctgaataaaaataacaccttttacaag
aggaggatagaagaattgggagagaggcttcaggaacagaacgatctgattattactcaa
aagaagcagataaaagagttatccacaaaatcagttgcaagcatcaaaccctatgataca
aacactgcagttgagcgtcttgaagaacctaaatcaagtctacctgtcatgtatgagcag
gcccccttggtacatatgctggagcccatagaggagctttcagaagaggaaaaagaaatt
gagaaagacgatcttaaaacaggtagaagtaaccaacatttaataaatgctttgaagact
gatccttctttaactaaagaattaagagttgttttggagcaagccctggaggaaaaactg
gaatccttgggaattaaagcaggtgtccgtggtatcccaaatgatcgcttaaataaaatt
ctacgtgccattgaatctgctagagaacacaaactgaagcaagagcctcacattcaacga
attcgagagtatcttgaacgccaagtcggcttcaggattgtagagagatcaacactgtct
aacagaactgtttccagtccttacattacttctgaaggtaaacagaagttcaatcaattg
ggaatttcctcatctaccataccacaaaaaccagtaaaacggtctttgacagctgtccgc
ccagctgaacaaagagcagccatcgctgagaatacatctacaccaaagaagctcatcgga
aatgaagcttccaaaaagacatctagtatcacaactccaccattcagttcagaggaagaa
gcagatgacgatgatgtcaaacagttgcgcgtctcacgagagttgttgcaaaaacagtca
aaaacatcgagcagcaaaattagtgcttttcagatggcttctgacaaaagtgatgtggat
gggacagaggaaagtgaaactgaagaaacaggaacacctgtcaaaacctcaaaaggaact
gttattcaaaagctgactgaacaagttggaaggagtctttctaaccatgcaaataagagc
aggccggctggagggatagatgttgcacaagcatttattaagaaagaagaggtgcaagaa
cccaagttcacagaagcagatgaagatgactgggatatatcatctatagaagaagactat
ttgttaatgaaagataataatggtcagaaggcatcaatagttcagaaaaatgagtcaaat
gctacgtctgttgtgcatgcgtggggtcttccaaagaagactgtaccaaaacaagaaggt
cctcgtgaagttgataatacaagcacattaaaaagcagcttagtcactgtaacagattgg
agtgattcttcagatatataa

DBGET integrated database retrieval system