KEGG   Gallus gallus (chicken): 418815
Entry
418815            CDS       T01006                                 

Gene name
LMO7
Definition
(RefSeq) LIM domain only protein 7 isoform X5
  KO
K06084  F-box protein 20
Organism
gga  Gallus gallus (chicken)
Pathway
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    418815 (LMO7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    418815 (LMO7)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     418815 (LMO7)
SSDB
Motif
Pfam: DUF4757 CH PDZ_6 PDZ PDZ_2
Other DBs
NCBI-GeneID: 418815
NCBI-ProteinID: XP_004938696
CGNC: 12702
Ensembl: ENSGALG00000016920
Position
1
AA seq 1873 aa
MTAAVPRARPGGGLTARHPLFLPAMDGREDAECGCEAAFAEARRWVETVTGKSFGTKDFR
AALENGVLLCDLINKIKPGIVRKINRLSTPIAGLDNINVFLKACENIGLKEAQLFHPGDL
QDLSNRVTVKPEETNRRVKNVLITLYWLGRKAQSNPYYNGPYLNLKAFEKLLGQALTKAL
EESSHLNRSGRDSGYGDIWYVDRGEPFPSSASHKRDDSLDSLDSLGSRSSTSFSSDITLK
GGIEGCDSDTDSELPFKMRDSHKDDRSYRRISVIEPKPATDFNRFLPTKNKQPTYMPAPL
RKKRTEKNEDNRRSWASPVYTESDGTFSSGRERNPVASCQNSRAECGLTNPASLQMVYEY
DSGSDSEDERRMPDVVMDDLAKRRFLVQKSPVSSAAPGHHFVLRNDSPKSCSQENYSAGP
LAAMLEPLSNQRRQRQLDTKVENKPGVNISPELSGYFDEDEEEETVIPNIEKDDLYFRKL
SSSASNTVVPFDKFLPKFWTPAEELLWKKIRKSSFKPWYKEIQGFSRKKSDSEDMDFAYK
QSSALVANQPRSSFEWNSSCRRDQSYKPTAEYMGSSLSQITEGKILEASDQPSQFLLLQA
LQKYSDYLSSETKTKIDPTSGPRLIKCRKNISFIPGCDDEGDTENGYLYPDLENDDLFVR
KTGAFHMNHVVLQDPQYFRKFSEQEPPLEGEIILQPREGQPVIPDLEKDDMIFRKILSQK
KEVPLSGAPDKYHPALFPDPWSLPEEIRSKFLCLLEKNATPEERKSSGRVLSPSSRHKRD
DMLARKIESWKVGSNMQPVNFIPGPCSEEDWKKWEAIREASKVRHKKRQMVERLFQKLSD
EQGSKSLNDVSAEDQQSLRKIRYEELQKIKEQLQEQDLKWQEDLAKWKNRRKSFTSELQK
KKEEREEIERRASEVSDRSSKPLKEMQQEREHKYDGRWSYSLTDDVFTEETAPTTRSTAK
DYLFEEETSYSTKDGKSQYATQRSKENLLKLESSATHEAPAVSKSLAEEQSSALLSTRYS
VNAQTGSAQVSASLPRSYQKTDTSRLTSVVTPRPFGVHSRGISSLPRSLTMDDAQKYNGE
VEKAKGTQTLTSSMFSLPDSTYSLSTSVLRRRGEEEEEEKEGVKSTPTPSSILPVKSQDR
DAGDSILKPEYCSPPDFVSLESSAENASLSEHDDSKSLEQYSELRISMNQRPGYSHNFGF
TTNWTSSGALVQTVEEDSPAALCQLQVDDEIIAINGTKVSQMDSSQWEEAITRALETGNL
VMDVRRYGKNDWGKDQPSLPHVRHKILNLTSMGTNIIGTSDNKWIDATSGERVSSVSTIS
TKREFSSSLQNSGTETKLINGMQGDLGSNEQRASEPISLKNLKRRSQFFEQGGPEPAMPD
LPVPSISAPSRRVWDQEEERKRQEKWQKEQDRLLQEKYKREQEKLREEWLRAKQEAEKEN
SKYLDEEQTVITSNIISVSTRAPSASSWRASPEVSTPEEPEGDGGSELAAHLLAKEEERR
LQEEEEAALRFERERELQELELERRRKEREQQYAEEQRRQAEMEEQRRQAEMEEQRRRAE
MEEQRQQAERQKEMSVETSQYQRRYERYEVSKTTENRSGQPLIDRHYERYESSKTIEERP
GQSFSDRNKSKSTSELNEFSANRNSTQSKHSERSWNTSESQKGSQKEHNLSAAELERQQI
LQEMRKKTSLHTDSSWIRQRSSSVHKEPISLYSSSMRRGESLDNLDSSRTSSWRHHSRLN
QSSSTSSLSSNQDHSRPVSTSNRAYMCTPSSAKAPPVTTSVRAPPASQTAPRVQSPVSAS
QPGSQMRSSALPVNATLGDPALELKSGSETTNSSATTAISDLKLDNQPPCEANLDMKPLL
QIEEEVIAADVDL
NT seq 5622 nt   +upstreamnt  +downstreamnt
atgacagcggctgttccccgcgcccgtcccggcggaggattgaccgcccgccacccgctc
tttctcccggccatggacggcagagaggatgccgagtgcggctgcgaggcggcgttcgca
gaggcgcggagatgggtggagacagttactgggaagagctttggaaccaaagattttcga
gcagctctagaaaatggagtcctgttgtgcgatttgattaacaagatcaaacctggcatt
gttaggaagatcaatcgtctgtcaactccaatagctggcttggataatataaatgttttt
ctgaaagcttgtgaaaatattggattgaaagaagctcaactttttcatccaggagacctt
caggatttgtccaatcgagttacagtcaaaccagaggagaccaacagaagagtgaaaaac
gttttgattacactatattggcttgggagaaaagcacaaagtaacccttactataatggt
ccatatctcaatcttaaagcatttgagaaattattagggcaagcactgactaaggcactt
gaagagtccagccacctaaacagaagtggcagggatagtgggtacggtgatatttggtac
gtggaccgaggggaaccctttccatcttcagcaagccacaaaagagacgattctttggat
agcttagactctcttggctcaaggtcctccacaagcttttcatcagacataaccttgaaa
ggtggcattgaaggctgtgatagtgacacagactcagaactgcctttcaagatgcgtgac
tcccataaagatgacaggtcctatcgaaggatttctgtaattgaaccaaaacctgctact
gacttcaatcgcttcttacccaccaaaaacaagcagccaacatatatgccagcaccccta
aggaagaaaagaacggagaagaacgaagacaacaggaggagctgggcaagccctgtctac
acagagtcagatggaacattttcaagtggacgtgaaaggaatcccgtagcttcctgccaa
aatagcagagcagaatgtgggcttacaaatccagcttccctgcagatggtctatgagtat
gacagtggctctgattcagaagatgaaagaaggatgcccgacgtggttatggatgactta
gcaaaacgtagatttctagtccaaaagagccctgtaagctctgctgcacctggacatcat
ttcgtgttgcgcaatgactctcctaaatcttgctcacaagaaaattattcggctggtccg
ctagctgcaatgcttgaaccactgagtaaccagaggaggcagaggcagttggatactaag
gtggaaaacaaaccaggcgttaacatttctccagaattatctgggtattttgatgaggat
gaggaagaagaaacagttatcccaaacatcgaaaaagatgatctctattttcgcaagcta
agttcttcagcatcaaatacagtggttccttttgacaaatttcttcctaagttttggact
ccagcagaagaattgctatggaaaaaaatcaggaaatcctctttcaaaccctggtataaa
gagattcaagggttcagtagaaagaaatcagattctgaggatatggattttgcttacaaa
caaagctctgcccttgttgctaaccagccaagatcaagtttcgaatggaatagcagttgc
agaagggatcaaagctataagccaactgctgaatatatgggaagctcattgtcacagatt
acagaaggaaaaatcttggaggcttctgaccagcccagtcagtttttgttacttcaggcc
ctgcaaaaatactctgactacttgtcttctgaaacgaagaccaaaattgatcctacttct
ggccctaggctcataaaatgtagaaagaatatttcctttataccaggatgtgatgacgaa
ggagacactgaaaatggatatctgtacccagatctagaaaatgatgacttgtttgttcgc
aaaactggggctttccatatgaatcatgttgttctccaggacccccagtatttcagaaaa
ttctctgagcaggagcctcctctagagggtgaaataattctgcaacctcgggaaggccaa
cctgtgattccagatttggaaaaagatgacatgatatttcgtaaaatcctctctcagaaa
aaagaggtgcctttatcaggtgctccagacaagtatcaccctgcgctctttcctgatcct
tggagtcttccagaggaaatccggtccaaatttctgtgtttacttgaaaaaaatgcaaca
cctgaggaaagaaaaagcagtggtagagtgttgtcaccgtcttcccgccataagagggac
gatatgctggcacgcaagattgagtcttggaaagtaggaagcaacatgcagcccgtaaat
tttatcccaggtccatgcagtgaagaagactggaagaagtgggaagcaatcagggaggcc
agcaaagttagacacaagaaacgtcagatggtggagagactgtttcaaaaactttctgat
gagcaagggagtaagtctttgaatgatgtcagtgcagaggaccagcagtcattgcgcaaa
attcgttatgaagaactacaaaagataaaagaacagctgcaagaacaagatctaaagtgg
caagaagatctagcaaaatggaagaatcgtagaaagagcttcacttcagaattgcaaaag
aaaaaggaagaaagagaagaaatagaaaggagagcctctgaagtttctgacaggagtagc
aagccactgaaagaaatgcagcaggaaagggaacacaaatatgatggcagatggtcgtat
tcactgactgatgatgtgtttactgaagaaacagcacctaccacacgatcaacagcaaaa
gattacctgtttgaggaagaaacctcctacagcactaaggatggcaaaagccagtatgct
actcagaggagcaaggagaatctactgaagctggagagctctgccacacatgaggctcct
gctgtctcaaagagtctggcggaagagcagagttcggctcttttgtctacgcgctactcg
gtgaatgctcaaactgggtcagctcaggtttcagcttctctccctagaagttaccagaaa
actgatacctccaggttaacatctgtggttacaccaagaccttttggtgtccactccaga
ggaatctcctcacttccacggtctctcacgatggatgatgctcagaaatacaatggagaa
gtggaaaaagctaaaggaactcaaactttaaccagcagtatgttttcactaccagactct
acatactctctctccaccagtgtactcagaaggagaggtgaggaggaagaagaggaaaaa
gaaggtgttaagtcaacacctactcctagttcaatattacctgtaaaatcacaagaccga
gatgctggcgatagtattcttaaaccagaatattgttctcctcctgattttgtttcactt
gaatcttctgcagaaaatgcgagtttgtcagaacatgacgattcaaaatccctggaacag
tacagtgaattgagaatcagtatgaaccagagacctggctacagtcacaactttgggttt
acaacaaattggacttcttcaggggccttagtacagacagttgaagaagatagccctgca
gcactttgtcagctgcaggtagatgatgagatcattgctatcaacggcacaaaggtttca
caaatggacagtagtcagtgggaagaagccatcaccagagcactagaaactggaaacctg
gtcatggatgttagacgatatggaaagaatgactggggcaaagaccagccttccctgcca
catgtaagacataaaatcctcaatctcaccagtatgggtaccaacattataggtacatct
gataataaatggattgatgcaacttctggagaacgtgtttcaagtgtctcaaccatatca
acaaaaagagaattctccagcagtcttcaaaattctggtacagaaacaaaattgataaat
ggcatgcaaggagatcttggatctaatgaacaaagagcatctgaacctatttctttgaaa
aacttaaaaaggcggtcacaattttttgaacaaggaggtccagagcctgcaatgcctgat
ctcccagtcccatccattagtgccccaagtcgtcgggtttgggatcaagaagaagaacga
aaacgacaggagaaatggcaaaaggagcaggatcgtttattgcaggagaaatacaaacgg
gaacaagaaaaactgagggaagaatggctacgagctaagcaagaagcagaaaaagaaaac
tccaaatatttagacgaggaacaaactgttataacctcaaacataatctcagtctctaca
cgagctccatctgcctccagctggagggcaagccctgaagtgagtactcctgaggagcca
gaaggagatggaggaagtgagctggcagcacacttgctggccaaggaagaagaaaggagg
cttcaggaggaagaagaagcagccctgcgttttgagcgagaaagggaactccaagaacta
gagcttgagagacgacgtaaagagagggaacagcagtatgctgaggagcagaggcggcag
gcagagatggaggagcagaggcggcaggcagagatggaggagcagaggcggcgggcagag
atggaggagcagaggcagcaagcagaacggcagaaggaaatgtcagtggagacatctcaa
taccaaagacgttatgagcgctatgaggtatctaaaacaacagagaaccgatctggccaa
cctctcattgacaggcattatgaacgctatgaatcttccaaaaccatcgaggagcgacct
ggtcagtcattttctgacaggaataaatctaagtcaacttcagagctgaatgaattcagt
gcaaacagaaatagtactcagagcaagcattcagagaggtcttggaacacgagtgagtca
cagaaggggtctcagaaggagcacaacctgtctgcagcagagttagagagacaacaaatc
cttcaggaaatgaggaagaaaacatctctacacacggacagcagctggattaggcaacgc
agttccagtgtgcataaggagcccatcagtctgtacagcagtagtatgaggagaggggag
tctttggacaatctcgattcttcaagaacaagctcgtggaggcaccactcaaggttgaac
cagtcctcctccacttcatctctgtcctctaatcaggatcacagccgcccggtgtctact
tcaaaccgggcctacatgtgcactccttcctctgccaaagcacctcctgtgaccacctct
gtgagagccccacctgcatcccagacagccccccgggtgcagtctcctgtctctgcttct
caaccagggtcgcagatgcgcagcagtgcgttgcctgtgaatgcgaccttgggggatccc
gctctggagctgaagtcaggatccgaaacaacaaactcttctgcaacgactgctatctca
gatttaaaactggacaaccaacctccatgtgaagcaaacctagatatgaaaccactgttg
cagatagaagaagaggtgattgctgctgatgtagatctataa

DBGET integrated database retrieval system