KEGG   Gallus gallus (chicken): 418857Help
Entry
418857            CDS       T01006                                 

Gene name
SUCLA2
Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00020  Citrate cycle (TCA cycle)
gga00640  Propanoate metabolism
gga01100  Metabolic pathways
gga01200  Carbon metabolism
Module
gga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    418857 (SUCLA2)
   00640 Propanoate metabolism
    418857 (SUCLA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    418857 (SUCLA2)
Enzymes [BR:gga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     418857 (SUCLA2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     418857 (SUCLA2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   418857 (SUCLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 418857
NCBI-ProteinID: NP_001006271
CGNC: 12755
Ensembl: ENSGALG00000016993
UniProt: Q5F3B9
Position
1
AA seq 463 aa AA seqDB search
MAASIICSRVSAGLRGSGFRAALGTATAKVLGGSPGILNNHGFQVQQQQQRNLSLHEYLS
MGLLQEAGISVPHGLVAKSPEEAYKIAKEIGTKDLVVKAQVLAGGRGKGTFEGGLKGGVK
IVFSPEEAKDISSKMIGKKLFTKQTGEKGRICNQVFICERRYPRREYYFAITMERSFQGP
VLIGSSQGGVNIEDVAAENPDAIIKEPIDIVEGIKKEQAVRLAQKMGFPPNLVDEAAENM
IKLYNLFLKYDATMIEINPMVEDASGVVMCMDAKINFDSNSAYRQKKIFDMQDWTQEDER
DRDAAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVQQVTEA
FKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLDLKIPIVVRLQGTRVDDAKALI
TASGLKILACDDLDEAAKMVVKLSEIVSLAKQAQVDVKFQLPI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccatcatctgcagccgggtgtcggccggcctgaggggtagcggtttccgc
gccgccctgggcactgccacggcgaaggtgcttggtggaagtccaggaatactcaataat
catgggtttcaggtgcaacaacagcagcagaggaacctgtcactacatgaatatttgagc
atgggactgttgcaggaggctggcatttctgttccacatggactggttgccaagtcgcca
gaagaagcttacaaaatagcaaaagaaataggtacaaaggatcttgtggtaaaagcacag
gttttagctggtggtagaggaaaaggaacatttgaaggtggcctcaaaggaggagtgaaa
atagttttttctccagaagaagcaaaagatatctcctccaaaatgattggaaagaagttg
tttaccaagcagacaggagaaaagggcaggatatgcaaccaagtatttatctgtgagcgc
agatatcccaggagagaatactattttgcaataacaatggaaaggtcatttcaaggtcct
gtgctgataggcagttcccagggtggtgttaatattgaagacgttgctgcagagaatcct
gatgcgataattaaggaacccattgatatagtagaaggcataaaaaaggagcaagctgtt
aggctagcccaaaaaatgggatttcctcctaatcttgtggatgaagcagctgaaaacatg
atcaaattatataatctctttctgaaatatgatgctaccatgatagaaataaatcctatg
gttgaagatgcatcaggagttgtgatgtgtatggatgcaaagataaattttgacagtaat
tcagcctatcgtcagaagaaaatctttgatatgcaagactggacgcaggaagatgaaaga
gacagggatgctgcaaaagcagatctcaactacataggattggatggaaatataggctgt
ttagtcaatggtgctggtttagctatggccacaatggatattattaaacttcatggtgga
actccagcaaacttccttgatgttggaggtggtgctacagtgcaacaagtgacagaagcc
tttaagcttattacctctgataaaaaggtactggctattctggtaaatatttttggaggc
attatgcgatgtgatgtaatagcacaaggaattgttatggcagtaaaggatttggaccta
aaaatacctattgtggtacgattgcaaggtacgcgagttgatgatgccaaagctttaata
actgctagtggcctcaaaattcttgcctgtgacgacttggatgaagctgccaaaatggtg
gtgaaactctctgagatagtaagcttagcgaaacaagctcaggtggatgttaaatttcag
ttgcccatttga

DBGET integrated database retrieval system