KEGG   Gallus gallus (chicken): 418865
Entry
418865            CDS       T01006                                 

Gene name
CAB39L
Definition
(RefSeq) calcium-binding protein 39-like
  KO
K08272  calcium binding protein 39
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    418865 (CAB39L)
SSDB
Motif
Pfam: Mo25 HEAT_2 CC2-LZ
Other DBs
NCBI-GeneID: 418865
NCBI-ProteinID: NP_001006272
CGNC: 12767
Ensembl: ENSGALG00000017005
UniProt: F1NV80
Position
1
AA seq 334 aa
MPLFSKSHKNPAEIVKILKENMAILEKQEKKTDKASEEVSKSLQAMKEILCGTTDKEPPT
EVVAQLAQELYNSGLLVTLIANLQLIDFEGKKDVSQIFNNILRRQIGTRSPTVEYISAHP
HILFMLLKGYESPNIALRCGIMLRECIRHEPLAKIILFSEQFRDFFKYVEMSTFDIASDA
FATFKDLLTRHKLLVADFMEQNYDTIFEDYEKLLHSENYVTKRQSLKLLGELILDRHNFA
IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPNKTQPIVEILLKNQPKLIE
FLSNFQKERTDDEQFTDEKNYLIKQIRDLKKPTA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcctttatttagtaaatcgcacaaaaatcctgctgagattgtgaaaattctgaaggaa
aacatggccatattggaaaaacaagaaaaaaaaacagacaaggcatcagaggaagtgtca
aaatctctgcaagcaatgaaggaaattctgtgtgggaccacagacaaggagccaccgaca
gaagtagtggctcagctggcacaagaattgtacaacagtggccttctagtgacacttatt
gccaacctgcagctcatagattttgagggtaaaaaggatgtttcccagatatttaacaac
atcctgagaagacaaattggcacacgaagccctactgtggaatacattagtgcccatcca
catatcctgttcatgcttctgaaaggctatgaatccccaaatattgccttacgctgtgga
attatgctgagggagtgcatccgacatgaaccattggccaaaatcatacttttttcagaa
cagttcagagacttcttcaagtatgtggaaatgtcaacatttgatatagcatctgatgcc
tttgctacattcaaggacttgttaacaaggcacaagttgttggtagcagattttatggaa
caaaattatgatacgatctttgaggattatgaaaaactccttcattctgagaattacgta
acaaagagacagtctttgaagctgctgggtgaattgattctagacagacacaacttcgcc
atcatgacaaaatatatcagcaaaccagagaatctgaagctgatgatgaacttgctgcga
gacaaaagccccaacattcaatttgaagcattccatgtgttcaaggtttttgtggccagt
ccaaacaaaacgcagcccatcgtggagatcctgttgaaaaaccagcccaagctcatcgag
tttctgagcaatttccagaaagagaggacggatgacgagcagttcaccgacgagaagaac
tacctgatcaagcaaatccgagacttgaagaagccgacggcgtga

DBGET integrated database retrieval system