KEGG   Gallus gallus (chicken): 418868
Entry
418868            CDS       T01006                                 

Gene name
RCBTB1
Definition
(RefSeq) RCC1 and BTB domain-containing protein 1 isoform X1
  KO
K11494  RCC1 and BTB domain-containing protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    418868 (RCBTB1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    418868 (RCBTB1)
SSDB
Motif
Pfam: RCC1 RCC1_2 BTB BACK
Other DBs
NCBI-GeneID: 418868
NCBI-ProteinID: XP_004938772
CGNC: 12769
Ensembl: ENSGALG00000017008
UniProt: E1BVG2
Position
1
AA seq 550 aa
MNSRLSLEKACKFMRRSNIMVDVGKWPIFTLLSPQEIASIRKACVFGTSANEAIYTTHND
EVFVFGLNCSNCLGTGDSQSTIVPKKLEALCGKKISSLSYGSGPHVLLCTEDGEVYAWGH
NGYSQLGNGATNQGVTPVQVCTNLLLKKVIEVACGSHHSMALSFDGDLYAWGYNNCGQVG
SGSTANQPTPRRVSNCLQDKMVVGIACGQTSSMAVVNNGEVYGWGYNGNGQLGLGNNGNQ
LTPCRVAALHGVCILQIACGYAHTLALTDEGLLYAWGANTYGQLGTGNKSNQLSPLQIMM
EKERVVEIAACHSAHTSAAKTQSGQVYMWGQCRGQSVVLPHLTHFACTDDVFACFATPAV
MWRLLSVEQEDFLTVAESLKKEFDSPETADLKFQVDGKYIHVHKAVLKIRCEHFRTMFQS
YWNEDMKEVIEIDQFSYPVYRAFLEYLYTDSVDLPPEDAIGLLDLATSYCENRLKKLCQH
IIKRGITVENAFSLLSAAVRYDAEDLEDFCFKFCVNHLTEVTQTTAFWQMDGPLLKEFIA
KASKCGAFKN
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgaattctagattgtcactggagaaagcctgtaagttcatgagacgcagtaacatcatg
gtggatgtgggaaagtggccaatatttaccttactgtcacctcaagaaatagcatctatt
cggaaagcatgtgtgtttggtacatcagccaatgaagctatatacacaacgcacaatgat
gaggtgtttgtttttggactgaattgcagcaattgtttaggaactggagatagtcagagc
acaatagtaccaaagaaattagaagccttatgtgggaagaagatttccagtctcagttat
ggaagtggaccacacgttctactttgcactgaagatggtgaagtgtatgcttggggacat
aatggctacagccagcttgggaacggtgcaaccaatcagggcgttactcctgttcaagtc
tgcacaaatctgttactaaagaaagtgattgaagtagcttgtggctctcatcattccatg
gcgttatcgtttgatggggatctatatgcttggggctataacaactgtggtcaagttgga
tcaggatctacagcaaaccagccaactcctcggagagtttcaaactgtttgcaggataaa
atggtagttggcattgcttgtggtcagacctcctccatggctgtagtaaacaacggtgag
gtttatggctggggttacaatggtaatggtcagctgggtcttgggaacaatggcaaccaa
ctaactccatgcagagtggcagcattacatggtgtgtgtatactccagattgcctgtggc
tatgcacacacattagcactaacagatgagggtttgctctatgcctggggagctaacact
tatgggcagctgggaactggcaataaaagtaaccagctaagccctctgcagatcatgatg
gaaaaagaaagggttgtggagattgcagcctgccactctgctcacacttcagctgccaag
acgcagagcggccaggtgtacatgtggggccagtgccgtggccagtctgtggtccttccc
cacctcactcactttgcctgcactgacgatgtgtttgcttgctttgctacccctgctgtc
atgtggcgtcttctctcagtagagcaagaagatttcttaacagtagcagagtccctgaag
aaggaatttgacagcccagaaaccgcagacctaaagttccaagtggatggaaagtacatc
cacgttcacaaagctgttctaaagatcaggtgtgaacacttcagaaccatgtttcagtcc
tactggaatgaggatatgaaggaagtgatagaaatagaccagttttcttaccctgtgtat
cgtgcctttctcgagtacttgtatacagacagtgtggaccttccgcctgaagatgcaata
gggcttttggacttggctacttcatactgtgaaaatagactgaaaaaactgtgtcagcac
attatcaagagagggattactgtggaaaatgcattttcattgttatctgctgctgtcaga
tatgatgcagaggacttagaggatttctgctttaagttctgtgtcaaccacttgactgaa
gtgacacaaactacagcgttttggcaaatggacggccccctgctaaaggagttcattgct
aaagccagtaaatgtggagcctttaagaactga

DBGET integrated database retrieval system