KEGG   Gallus gallus (chicken): 418885Help
Entry
418885            CDS       T01006                                 

Gene name
TPTE2
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 isoform X1
  KO
K18079  PTEN homologous phosphatase
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    418885 (TPTE2)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    418885 (TPTE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 Ion_trans DSPc PTPlike_phytase Y_phosphatase PKD_channel Y_phosphatase3 Virul_fac_BrkB
Motif
Other DBs
NCBI-GeneID: 418885
NCBI-ProteinID: XP_004938790
CGNC: 50872
Ensembl: ENSGALG00000017031
UniProt: E1BUX1
Position
1
AA seq 511 aa AA seqDB search
MTTVRYEQGSELTETSSSPTADEPTIKIDDGRDEGNEQDSCSNTIRRKISPFVMSFGFRV
FGVVLIIVDIIVVIVDLAISEKKRGIREILEGVSLAIALFFLVDVLMRVFVEGFKNYFRS
KLNTLDAVIVVGTLLINMTYSFSDLAATDQMPRMVTLLRVLRIVILIRIFRLASQKKQLE
VVTRRMVSENKRRYMKDGFDLDLTYVTDRVIAMSFPSSGKQSFYRNPIEEVARFLDTKHA
DHYKVYNLCSEKGYDPKYFHYRVERIFIDDHNVPALQDMLKFTASVREWMNQDEKNIIAI
HCKGGKGRTGTMVCTWLIHSDQFESAKESLDYFGERRTDRTMSTKFQGVETPSQSRYVGY
YEILKNKYNFQLPPERQLKIKNLKIHSIHGVGKGNGTDMKVQIIMKKQVVLECVCATQGN
CKLFFDSESDSVVIGLEDSPVISGDVKVRFESNSDLPKGYDDCPFFFWFNTSFIENNRLY
LPRNELDNPHKSKTWKVYSEAFAVEMNFTEL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgtgaggtatgaacaggggtcagagctcactgaaacttcgagctctccaaca
gcagatgagcccacgataaagattgatgatggtcgtgatgagggtaatgaacaagacagc
tgttccaataccattaggagaaaaatttccccgtttgtgatgtcatttggattcagagta
tttggagttgtgcttatcattgtagacatcatagtggtgattgtggatctggccatcagt
gagaagaaaagaggcattagagagattcttgaaggtgtttccctggctatagcactcttc
ttccttgttgatgttctcatgagagtgtttgttgaaggcttcaagaactatttccggtcc
aaactgaatactttggatgcagtcatagtagtgggcactctgctaattaatatgacctac
tccttctctgaccttgctgccacagatcagatgccgagaatggttactcttcttcgagtt
ctgagaattgttatcttaataagaatatttcgcctggcttcacagaagaaacaacttgaa
gtggtaaccagaagaatggtctctgaaaacaaaaggcgttacatgaaagatggttttgat
ctggatctcacttatgttactgatcgtgttattgcaatgtcttttccatcttctgggaag
cagtctttctataggaatcctatagaggaagttgcgagatttttggacaccaagcatgca
gaccactataaagtctacaatctttgcagtgaaaaaggctatgaccctaagtacttccac
tacagggtagaaaggatctttattgatgaccacaatgtcccagcattacaggacatgctg
aaattcactgccagtgtccgtgaatggatgaatcaagatgagaagaatatcatagcaatt
cactgtaaaggaggcaagggtagaactggaacaatggtctgtacctggcttatacacagt
gaccagtttgagagtgcaaaggagagtttagactactttggagagagaagaactgacaga
actatgagtaccaaatttcaaggagttgaaactccatcccagagtaggtatgttgggtat
tatgagatcctgaaaaacaagtataacttccaactcccaccagagagacaactcaaaata
aaaaacctcaaaatccactctatacatggagttgggaaaggcaatggaactgatatgaag
gtgcagataataatgaaaaagcaagttgtgttggaatgtgtgtgtgccacacaaggaaac
tgcaagctcttctttgattctgaaagtgactctgtagtcattggcttggaagacagccct
gttataagtggtgatgtgaaagtcagatttgaatctaattctgatcttccgaaaggctac
gatgactgcccatttttcttctggttcaacacttcctttattgaaaataacagactgtac
cttcccaggaacgagctggataaccctcacaagtcaaaaacatggaaagtctacagtgag
gcgtttgctgtagagatgaactttactgagctgtaa

DBGET integrated database retrieval system