KEGG   Gallus gallus (chicken): 418910
Entry
418910            CDS       T01006                                 

Gene name
PDS5B
Definition
(RefSeq) sister chromatid cohesion protein PDS5 homolog B
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    418910 (PDS5B)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    418910 (PDS5B)
SSDB
Motif
Pfam: DUF5578 PI-TkoII_IV
Other DBs
NCBI-GeneID: 418910
NCBI-ProteinID: NP_001012845
CGNC: 12819
Ensembl: ENSGALG00000017070
UniProt: A0A1D5PEL0
Position
1
AA seq 1446 aa
MAHSKTRANDGKITYPPGVKEISDKISKEEMVRRLKMVVKTFMDMDQDSEEEKELYLNLA
LHLASDFFLKHPDKDVRLLVACCLADIFRIYAPEAPYTSPDKLKDIFMFITRQLKGLEDT
KSPQFNRYFYLLENIAWVKSYNICFELEDSNEIFTQLYRTLFSVINNGHNQKVHMHMVDL
MSSIICEGDTVSQELLDTVLVNLVPAHKNLNKQAYDLAKALLKRTAQAIEPYITNFFNQV
LMLGKTSISDLSEHVFDLILELYNIDSHLLLSVLPQLEFKLKSNDNEERLQVVKLLAKMF
GAKDSELASQNKPLWQCYLGRFNDIHVPIRLECVKFASHCLMNHPDLAKDLTEYLKVRSH
DPEEAIRHDVIVSIVTAAKKDLLLVNDHLLNFVRERTLDKRWRVRKEAMMGLAQIYKKYS
LQSEAGKEAAKQISWIKDKLLHIYYQNSIDDRLLVERIFAQYMVPHNLETNERMKCLYYL
YATLDSNAVKALNEMWKCQNLLRHQVKDLVDLIKQPKTDASSKAIFSKVMVITRNLPDPG
KAQDFMKKFTQVLEDDEKIRSQLEMLVSPTCSCKQAEGCVREITKKLGNPKQPTNPFLEM
IKFLLERIAPVHIDTESISALIKQVNKSIDGTADDEDEGVPTDQAIRAGLELLKVLSFTH
PISFHSAETFESLLACLKMDDEKVAEAALQIFKNTGSKIEEDFPHIRSALLPVLHHKAKK
GPPRQAKYAIHCINAIFSSKETQFAQIFEPLHKSLDPSNFEHLITPLVTIGHIAMLAPDQ
FAAPLKSLVATFIVKDLLMNDRLPGKKTTKLWVPDEEVSPETLVKIQAIKMMVRWLLGMK
NNHSKSGTSTLRLLTTILHSDGDLTEQGKISKPDMSRLRLAAGSAIVKLAQEPCYHEIIT
LEQYQLCALAINDECYQVRQIFAQKLHKGLSRLRLPLEYMAICALCAKDPVKERRAHARQ
CLVKNINVRREYLKQHAAVSEKLLSLLPEYVVPYTIHLLAHDPDYVKVQDIEQLKDIKEC
LWFILEILMAKNENNSHAFIRKMVENIKQTKDAQGPDDAKMNEKLYTVCDVAMNIIMSKS
TTYSLESPKDPVLPARYFTQPDKNFSNTKNYLPPEMKSFFTPGKPKAANVLGAVNKPLSS
AGKQSQSKSSRMETVSNASSSSNPSSPGRIKGRLDSTEMDHSENEDFTLSSPLPGKKTDK
RDDSDLSELEKPRGRKKPAITDSEEKLSIDDLNKLGQDQKLRGSQRGRKRPAVVSESDET
QWQEEKRLKEDVIESEDEQNSPPKKGRRGRPPKPNNGGTPKEEPAAKSSKRSKKKQTSAA
AVEEEEEEEERQTENIEQKPKGRQNRSTKRTQQRAEPSESSTVESAQSTPQNRRGRSSKT
PPSQQKKVRAGRSKQAASKENESSEEMDVFQSSSPVSDDVPQEEVMEEEEVSTINVRRRT
SKRERR
NT seq 4341 nt   +upstreamnt  +downstreamnt
atggctcattcaaagacgagagccaatgatggaaaaatcacatatcctccaggagtcaaa
gaaatctccgacaaaatatctaaagaagagatggtgagaaggctaaagatggttgtgaaa
accttcatggatatggaccaggactctgaagaagaaaaggagctgtacctaaatcttgct
ttacatctcgcttcagattttttcctcaagcatcctgataaagacgtacgtttgctggta
gcttgttgtcttgctgatattttcagaatttatgcccctgaagctccatacacttcacca
gataagctaaaggatatatttatgttcataacaaggcaacttaagggtttagaagataca
aaaagcccccagttcaatcgatatttttatttacttgagaacattgcttgggtgaagtct
tataacatatgttttgagttagaagacagcaatgagattttcacacaactgtacaggacg
ctgttttcagtaataaacaacggacataaccaaaaagtacacatgcacatggttgatcta
atgagctctattatttgtgagggagatactgtgtcacaggaacttttggatacagtgtta
gttaatctagtgccagcgcataagaatttaaacaaacaagcctatgatttggcaaaagct
ttgcttaagaggacagcacaagcaattgaaccatacattactaatttcttcaatcaggtt
ctgatgcttgggaaaacatcaattagcgacctgtcagagcatgtgtttgacttgattctg
gagttatacaatattgacagccacctcttactttctgttctaccccagcttgaattcaaa
cttaagagcaatgacaatgaagaacgtctgcaggttgtaaaacttctggcaaaaatgttt
ggggcaaaggattcagagttggcatctcagaacaaacccctctggcagtgctacttgggg
aggtttaatgatatccatgtacctattcgtcttgaatgtgtgaaatttgcaagtcactgc
cttatgaaccatcccgacctagcaaaagacttaacagaatatcttaaagtaaggtcccat
gatcctgaagaggcgataaggcatgatgttatagtatccatagttactgctgctaaaaaa
gatcttctgcttgtcaatgatcacctgcttaattttgtcagagaacgaacactggacaag
cggtggagagtgaggaaagaagctatgatgggacttgcacagatatacaagaaatattca
ttacagtcagaagcaggaaaagaagctgcaaaacagatatcgtggatcaaagataaactt
ctgcatatatattatcaaaacagtattgacgaccgattacttgtcgaacgcatctttgct
cagtacatggtccctcacaacttggaaacaaatgaacgaatgaaatgtttgtattacctt
tacgcaacactggattcaaatgctgtgaaagcattgaacgaaatgtggaaatgtcagaat
ctgctacgacatcaagtaaaagatttggttgacctaataaaacaaccaaaaacagatgcc
agcagtaaagctatattctcaaaagtgatggtcataacaagaaaccttcctgatccaggg
aaagctcaagatttcatgaagaaattcacacaagttctagaagatgatgaaaaaataaga
agtcaattagaaatgcttgttagcccaacatgttcgtgcaaacaggctgagggatgtgtg
agggaaattacaaagaagttgggcaacccaaaacaaccaacaaatcctttcttggagatg
attaagtttcttcttgagagaattgctcctgtgcacattgatactgaatccatcagtgcc
cttatcaagcaagtaaacaaatctatagatggaacagctgatgatgaagatgagggtgtg
cctactgaccaggcaatcagagcaggtcttgaattgcttaaggtactttcatttacacat
cctatctcatttcattcagctgaaacttttgaatctcttctggcttgcttgaaaatggat
gatgaaaaagtggcagaagccgcattacaaattttcaaaaatacgggaagcaaaattgaa
gaagactttcctcatataagatctgctttgcttccagtgttgcatcataaagctaaaaaa
ggacctcctcgtcaagccaagtatgctattcactgcatcaatgcaatattttccagcaaa
gaaacacagtttgcacagatatttgagccactgcataaaagtctggatccaagcaatttt
gagcatctcattacaccactggttactattggccatatagccatgctagcacctgatcag
tttgctgcccctttgaaatctttggttgccacttttattgttaaagacttgctaatgaat
gataggcttccaggaaaaaagacaacaaaactttgggtcccagatgaagaagtgtctcct
gaaacacttgtcaaaattcaggccatcaagatgatggttcgatggttgctaggaatgaag
aacaatcacagtaaatcaggaacttctactctaaggttgctaacaacaatattacacagt
gatggagacttgacagagcaggggaaaattagtaaacctgatatgtctcgattgaggttg
gccgcaggtagtgctattgtgaagctggcacaagaaccttgttaccatgaaatcatcacc
ttagaacagtaccagctgtgtgcactagccataaacgatgaatgttaccaagtgaggcaa
atatttgctcagaaacttcacaaagggctttctagactacggctgccactagaatatatg
gctatttgtgcactgtgtgcaaaagatccagtgaaagagagaagagctcatgctaggcag
tgccttgtgaagaacataaatgtcagaagggaatatctgaagcaacatgcagcagttagt
gagaaactgttgtcgcttctaccagagtatgttgttccttatacaatacatcttctagct
catgacccagattatgtcaaagtccaggacatcgaacaactaaaggacattaaagagtgt
ttgtggttcatactggaaatattgatggctaaaaatgagaacaacagtcatgcatttatc
agaaaaatggtagaaaatattaaacagactaaagatgctcaaggaccagatgatgcaaaa
atgaatgaaaaactctacacagtctgtgatgtagcaatgaatatcattatgtcaaagagt
acaacatacagtttggaatcccctaaagatcctgtacttccagcacgatattttactcaa
cctgacaagaattttagtaacaccaaaaattatcttcctccagaaatgaagtcatttttc
actcctggaaagcccaaagcagccaatgttcttggagcggttaacaagcctctttcgtca
gcaggcaagcagtctcaatccaaatcttcacgaatggaaactgtaagcaatgccagcagc
agttcaaatccaagctctccaggaaggatcaaagggaggcttgatagtactgagatggac
cacagtgagaatgaagacttcacactgagttcaccattaccagggaagaaaactgacaaa
agggacgactctgatctttcagagcttgagaagcctagaggaaggaagaaaccagctatc
acagactcagaagagaagctaagcatagatgacctaaataaactgggacaagaccagaag
ctaagaggcagtcaacggggaaggaagagacctgcagttgtttcagagtctgatgaaaca
caatggcaagaggaaaaaaggctaaaagaagatgtaatagaaagtgaggatgaacagaac
agtccgccaaagaaagggagaagaggacgccctcccaaaccaaataatgggggaacacca
aaggaagaaccagcagcaaagtcatcaaaaaggagcaaaaaaaaacaaacgtcagcagcg
gcagtagaggaggaagaagaggaagaagaaaggcaaactgaaaacattgaacaaaagcca
aaaggcaggcaaaacaggtcgacaaaaagaacacagcagagagcagagccatctgaatct
agtacagttgaatcagcacagtctacgccacagaacagacgaggaaggtcatcaaaaaca
ccaccatcacagcaaaaaaaagtccgtgcgggacgttcgaaacaagcagctagtaaggag
aatgaatccagcgaagagatggatgtatttcagagtagttcacctgtcagtgatgatgtt
ccccaggaagaagtaatggaagaagaggaagtttccacaatcaatgtgcgtcgcagaact
tccaaaagggaaaggcgatga

DBGET integrated database retrieval system