KEGG   Gallus gallus (chicken): 418943
Entry
418943            CDS       T01006                                 

Gene name
TNFRSF19
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 19 precursor
  KO
K05155  tumor necrosis factor receptor superfamily member 19
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    418943 (TNFRSF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:gga04050]
    418943 (TNFRSF19)
Cytokine receptors [BR:gga04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   418943 (TNFRSF19)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 418943
NCBI-ProteinID: NP_001073572
CGNC: 12859
Ensembl: ENSGALG00000017119
UniProt: A1XGV6
Position
1
AA seq 409 aa
MDPKGLQGEDKLKMLIILLAYLLSRVICETGDCREQEFRDHAGNCILCKQCGPGMELSKE
CGFGYGEDAQCMTCRPNRFKEDWGFQKCKPCLDCALVNRFQKANCSATSNALCGDCLPGF
YRKTKLGGFQDMECVPCGDPPPPYEPHCTTKVNLVKIPSTASSPRDTALAAVICSALATV
LLALLILCVIYCKRQFMEKKPSWSLRSQDIHYSGSELSCFDRPRLNEYDHRTCCQCQRST
SQTCGPVHLIPSLCCDETCSMEHSSHSCALQSQTTLNERTSDSVGEMIPAFLGSLSHSAC
GDISDAWPLMQNSACCDSISFCESYSELAGVAAKSCSLETENETAIESDNNQELSDVLTS
AKSPDGNIAKSFEISKHRTYIEVSSLQNSAAAESQPNTKCNGTADDSTD
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggatcctaaaggattacaaggagaagacaaattgaagatgcttataatcttacttgca
tatttgctaagtagggtaatttgtgagactggagattgcagagaacaagaatttagggac
cacgctgggaactgtattctctgcaaacagtgtggaccaggaatggaactctcaaaggaa
tgcggctttggatatggggaggatgcacagtgcatgacttgcaggccaaacagattcaag
gaagactggggctttcagaagtgcaagccttgtctggattgtgctctagttaaccgcttt
cagaaggccaactgttctgccaccagcaatgcactatgtggagactgtttaccggggttt
tataggaagaccaagcttggaggctttcaagacatggagtgtgttccctgtggtgatcct
cctcctccctatgaaccccactgtaccaccaaagtaaaccttgtgaagatcccatcaact
gcttccagtcctcgagacactgctctagcagcagttatatgcagtgcacttgcaacagtg
ctcttggctcttcttattctttgtgttatctattgcaagaggcagtttatggagaagaaa
ccaagctggtctctgagatcacaagacattcattacagtggctctgaattgtcttgtttt
gatagaccacggctaaatgaatacgaccacagaacgtgctgccagtgccagagaagcacg
tcacagacctgtgggcctgttcatttgattccttcactgtgttgtgatgaaacctgtagc
atggaacacagcagtcacagttgtgctttgcaatcacagactacacttaatgaaaggact
tctgactctgttggagaaatgattcctgccttccttggttctctttcacactctgcttgt
ggagacatttcagatgcttggcctctgatgcaaaactcagcttgttgtgacagcatttct
ttctgtgaatcatattcagaactggctggggttgctgcaaaatcctgcagtctggagact
gaaaatgaaactgccattgagtcagataataaccaggagctaagtgatgtacttacttca
gcaaagtctcctgatggaaacattgcaaagtcctttgaaatctccaagcatagaacatat
atagaagtttcatcacttcagaactcagctgctgctgaatcccagccaaatacaaagtgt
aatggaacagcagatgactctacagactga

DBGET integrated database retrieval system