KEGG   Gallus gallus (chicken): 418954
Entry
418954            CDS       T01006                                 

Gene name
ZMYM2
Definition
(RefSeq) zinc finger MYM-type protein 2 isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: zf-FCS DUF3504 YHS Arc_trans_TRASH Ribosomal_L24e
Other DBs
NCBI-GeneID: 418954
NCBI-ProteinID: XP_004938871
CGNC: 50883
Position
1
AA seq 1261 aa
MDTSSLGGLELSEHTPDLLANTTMAAGLANVGNTFAGPTSSLVSRPSKFQNSTVEDDDDV
VFIEPVQTPQNSTSLIAEQRNAAFALSKNDELQGDDCKMLPPPKDLNSQKGSISETIIID
DEEDIETNQGQEKNASGFNERRLPECKNRANDMDFSASSFSRSKTKTGVGPFNPGRMNVA
GDVFQNGESVTHHNPDSWISQSASFPRNQKQPGVDSLSPVASLPKQIFQPSTQQPPPSKQ
VKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCRKDITTMKGT
IVAQVDSSESFQEFCSTSCLSFYEDKQNPSKGALNKSRCTICGKLTEIRHEVSFKNMTHK
LCSDHCFNRYRMANGLIMNCCEHCGEYLPSKGAGNNTLTIDGQQKRFCCQNCVGEYKQKY
GKLTSCTGCRAQCRFFDMTQFIGPNGYLEPYCSTACMNTHIPKYAESRSMEIICHFCKRN
SLPQYQATMPDGKLYNFCSSSCVAKFQALSDQSSTNGQFVSPGDIQLKCNYCKSSFCSKP
EVLEWENKVYQFCSRACSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGIKRPFCSEGCKL
LYKQDFARRLGLRCVTCNYCSQLCKKGATKELDGVVRDFCSEECCKKFQDWYYKAARCDC
CKSQGTLREKVQWRGEMKHFCDQHCLLRFYCQQNEPNLATQKGPENLQYDQGCQTPRTKI
TGSAPPPSPTPNREMKNKAVLCKPLTMTKATYCKPHMQTKSCQTEDDWKKEYVPVPIPVP
IYVPVPMNMYSQTVPVPTSIPVPVPVPIFLPTTLDSTEKIFAAIEDLRGKVPSNPLETEL
LTLSGMVPEHEGKAEVSDVASVIAESNLLNSETEAQTSLPDVPYEPDLDIEIDFPRATEE
LDTENEFLLPPVFGEEYEEQPRPRPKKKGVKRRAVSEYQSHDDSSENSECSFPFKYTYGV
NAWKHWVKSRHLDEELPELEELKSTKSVKLKEDLLSHTSAELNYGLAHFVNEIRRPNGEN
YAPDSIYYLCLGIQEYLYGSNRKDNIFIDPIYQTFEQELNKILRSWQPSILPDGSIFSRV
EEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRQWKKNPLTMES
KACLRYQVSSLCRADSEDKITTGKRKHEDDEPVFEQIENTSDPTRCPVKLFECYLSKSPQ
NLNQRTDMFYLQPECSVSSDSSVWYTSTSLDRNTLENMLVRVLLVKDIYEKDNYELDEDI
D
NT seq 3786 nt   +upstreamnt  +downstreamnt
atggacacaagttctctgggaggattagaactgtctgaacatactcctgacctactagca
aataccaccatggcagcaggtcttgcaaatgtaggcaatacatttgctggtccaacaagt
tctttagtttctagaccgagtaaattccagaactctactgtagaagatgatgatgatgta
gtttttattgaacctgtacaaacgccacaaaattctacatcactgatagcagaacaaagg
aacgctgcatttgcattgtcaaaaaatgacgaacttcaaggagatgattgcaaaatgctt
cctcctccgaaagacttgaattctcaaaaggggagtataagtgaaactattattattgat
gatgaagaagatattgaaacaaatcaaggacaagagaagaatgcttccggttttaatgag
cgaagacttccagagtgtaaaaacagagccaacgatatggatttctcagcttccagtttt
tcaagaagtaagaccaagactggtgtaggacctttcaatcctggtagaatgaatgtggct
ggcgatgtatttcaaaatggagaatctgtgactcatcataatcctgattcttggatatcc
cagtcagcttcgttccctaggaatcaaaagcaaccaggtgtggattctttatcaccagta
gcatcactacccaagcagatcttccagccttctactcagcagccaccgccgtctaaacag
gttaaagttacatgtgcaaactgcaaaaagcctttgcaaaagggacagactgcttatcaa
cggaaaggatcagctcatcttttttgttctactacctgcctctcatcattctcacacaaa
cccgctccaaagaaactttgtgtcatgtgcagaaaagatataacaacaatgaaaggtacc
atcgttgctcaagttgattcaagtgagtctttccaggagttctgcagtacatcatgttta
tccttctatgaagataaacagaacccttcaaaaggagctttgaataagtcaagatgcact
atctgtggtaaactaactgagattcgtcatgaagttagctttaaaaatatgactcataag
ctgtgcagtgaccactgcttcaatagatacaggatggcaaatggtttaataatgaattgc
tgtgagcactgtggggagtatttgcccagtaaaggagctggaaacaatactcttactatt
gatggtcagcagaaaagattctgctgtcagaactgcgttggtgaatacaagcagaaatat
ggcaaattaacatcttgtactggctgcagagctcagtgcaggttttttgacatgactcag
ttcataggacctaatggatatttggagccatactgctcaactgcatgcatgaacacacac
ataccaaaatatgcagaatcacgaagtatggaaattatttgccacttttgtaaacgaaac
tctttacctcagtatcaagccacaatgcctgatggaaaactgtacaacttttgcagttcc
agttgtgtagctaaatttcaggctctcagtgatcagtcttcaacaaatggtcagtttgtg
tctcctggtgatattcagttgaaatgcaattattgcaagagttctttttgttcaaagcca
gaagtgctagaatgggagaataaagtgtatcagttctgcagcagagcatgttctgatgat
tataagaaactgcactgcatagttacgtactgtgaatactgtcaagaggagaaaacactg
catgagactgtgaatttctctggcatcaaaagaccattttgtagtgaaggctgcaagctg
ctatataaacaagactttgcaagacggttaggactgagatgtgttacttgtaattactgc
tcacagctgtgcaaaaagggagcaactaaggaacttgatggtgtagtgagagatttctgc
agtgaagagtgctgtaaaaaatttcaggactggtactacaaggctgcgcggtgtgactgt
tgtaagtcacagggaactctcagagagaaagtgcagtggcgtggagaaatgaaacacttt
tgtgatcagcactgtttgctccgtttctactgtcaacaaaatgaaccaaatctggcaacc
caaaaaggaccggagaacttgcaatacgatcagggctgtcaaactccccgaacaaaaata
acagggtcagcaccaccgccttccccaacccctaacagagagatgaagaacaaggctgtt
ctgtgcaagcctttgacaatgacaaaagccacgtactgtaaacctcatatgcagacaaaa
tcttgtcagacagaagatgattggaaaaaagagtacgtcccagtgcctattcctgtaccc
atctatgtcccggtgcctatgaacatgtatagccaaactgttcctgttcctacgtcgatt
cctgttcctgtgccagttcccattttcttgcccactactctggacagcactgagaaaatc
tttgcagcaatagaagacctgaggggcaaagtgccctcaaatcctctggagacggagcta
ctgaccttgtcagggatggtgcctgaacatgagggaaaagcagaagtttctgatgtggcc
agtgtgatagctgagtccaatctactaaattcagaaacagaggcacagacaagcttgcca
gatgttccctatgaaccagacctcgatattgaaatagactttccaagagcaactgaagag
cttgatacagaaaatgagtttttattgcctcctgtttttggggaagaatatgaggagcag
ccaaggcctcgtcccaaaaagaagggagtgaagaggagagcagtgtcagagtaccaatca
cacgatgatagctctgaaaactcagaatgtagttttccattcaaatacacatatggtgtg
aatgcatggaagcactgggtaaagtctcggcatttagacgaagagcttccagagttagag
gaactgaaatcaacaaagtctgtgaaattaaaggaagatctattatcacatacttcagct
gagttaaactatgggttggcccattttgtcaatgaaattcgaaggcctaatggagagaac
tatgcacctgacagcatctattatctgtgtcttgggattcaggagtatttgtatggaagt
aaccgaaaagacaacatctttattgatccaatctaccagacgtttgaacaagaattaaat
aaaatccttagaagttggcaaccaagcatacttccagatggatcaatattctctcgagtg
gaagaggattatctatggaggattaaacagctaggatcacattcgccagttgctcttctg
aatactctgttctactttaacaccaagtattttggtctgaaaacagtggagcagcactta
agactttcttttggcactgttttcagacagtggaaaaaaaatcctctaacaatggaaagc
aaagcttgtcttcgatatcaggtgtcttccctgtgcagagctgatagtgaagataaaatt
actactgggaaaaggaaacatgaagatgatgaaccagtatttgaacagattgaaaacacg
tctgatccaactagatgccctgtgaaactgtttgagtgctatctgtctaaaagcccacag
aatctgaatcagaggacggacatgttctatttgcagccagaatgctctgtctcctcagat
agttctgtctggtacacttccacctcactggaccgcaacactttggaaaatatgctcgta
cgggttcttttagtaaaagatatttatgaaaaagacaattatgaactggatgaagacata
gattaa

DBGET integrated database retrieval system