KEGG   Gallus gallus (chicken): 418999
Entry
418999            CDS       T01006                                 

Gene name
TM4SF1a
Definition
(RefSeq) transmembrane 4 L six family member 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: L6_membrane EI24
Other DBs
NCBI-GeneID: 418999
NCBI-ProteinID: NP_001264759
CGNC: 50893
Ensembl: ENSGALG00000028629
UniProt: R4GLJ0
Position
1
AA seq 196 aa
MCTGKCSRCIGITLFPLAACAIVSNILLYFPNGRVLQLSEITDLVWFFQGILGAGILVIL
PAFMMLGAGGAGCCANRCGMLLSVLLALLGFAGAVYCAIFSSMGLIGGPLCDTGDGEYLY
PFRNNTLEYNYLFNQTTWSICKEPENIILWNIVLFSILLAIGVIEAILCLIQVTNGLIGF
VCGTCMRRRKTNISGM
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtgcacagggaagtgttcaaggtgcattgggatcaccctgttcccgctggctgcatgt
gctatagtctccaacatcctcctgtatttccccaatggacgagttctgcagctcagtgag
ataaccgatctggtctggtttttccaaggcattctgggagctggaatactggttattttg
ccagcattcatgatgctgggagcaggcggagcaggatgttgcgctaacagatgtgggatg
ctgctgtcagtgcttctggctctgctggggtttgcaggagcagtgtactgtgcaatcttc
tcctcaatggggctgattgggggccctctgtgtgacacaggtgatggagaatacctctac
cctttcagaaacaacactctggaatacaattatttgttcaaccagacaacatggagcatt
tgcaaagaacctgaaaacatcatcctttggaacattgtccttttctctattctcctggcc
attggtgtgattgaagcaattctttgcttaattcaggtcaccaatggtctcattggcttt
gtgtgtggcacatgtatgaggagaagaaagacaaacatttcgggaatgtga

DBGET integrated database retrieval system