KEGG   Gallus gallus (chicken): 419001
Entry
419001            CDS       T01006                                 

Gene name
C1H11ORF54
Definition
(RefSeq) ester hydrolase C11orf54 homolog
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: DUF1907
Other DBs
NCBI-GeneID: 419001
NCBI-ProteinID: NP_001264206
CGNC: 12940
Ensembl: ENSGALG00000017219
UniProt: F1NY09
Position
1
AA seq 316 aa
MAKVEKFAFHVPSLEELAGVLQKGLKENFADAQVSVVDCPDLTQEPFNFPAKGICGKPRI
ADVGGVPYLIPLAQKEKVYDLNTVAKDIELPGAFILGAGAASSRVLGVNAELIPIVQTKN
EKKPAINGSYVAQINPADKGCLLEKYSNKYSDCEFGLLANLYASEGQPGKVVEVKANGRT
GELNFVSCLRQILEKHYGEKPVGMGGTFIIQKGKAKIHIMPPEFSACPLNTDEDVNNWLK
FFEMKAPLICQPVIVSRDPGFDLRLEHTHCFSQHGEGGHYHTDTTPDAVQYRAYLVPAEL
LFRIDRPKETHSVGRD
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcaaaggtcgaaaagtttgcttttcatgttccaagcctggaggagcttgctggagtt
ttgcagaaaggacttaaagagaactttgctgatgcccaagtctctgttgtagactgtcct
gatctgactcaggagcctttcaattttcctgctaaaggaatctgtggaaagcctagaata
gcagatgtgggaggtgttccatacctcataccacttgcacagaaagaaaaagtttatgat
ctaaatactgttgcaaaagacatagagcttcctggagctttcattcttggagctggggct
gcttcatctagagttcttggcgtaaatgctgagcttatccccattgtgcaaacaaagaat
gaaaaaaagcctgctataaatgggagctacgttgctcagataaatcctgcagataaagga
tgcctgctcgaaaagtatagcaataaatactcagactgtgaatttgggctgttggccaac
ctttatgccagcgagggccaacctggtaaggttgttgaagtgaaagccaatggaagaact
ggggagcttaactttgtgtcttgtctaagacaaattttagagaaacactatggagaaaag
ccagttgggatgggtggtacgtttatcattcagaagggaaaagcaaaaattcacattatg
cctccagaattttctgcctgccctctgaacactgatgaggatgtgaataactggctcaaa
ttctttgaaatgaaggctccactgatttgtcagccagtaatcgtttcaagagatccaggc
ttcgacctgcgcctggagcacacgcactgcttcagccagcacggggagggcggccattac
cacaccgacaccacgccggacgccgtgcagtaccgcgcctatttggtgcccgcggagctg
ctcttccgcatcgaccggcccaaggagacccacagcgtggggcgggactga

DBGET integrated database retrieval system