KEGG   Gallus gallus (chicken): 419063
Entry
419063            CDS       T01006                                 

Symbol
RAB6A
Name
(RefSeq) ras-related protein Rab-6A
  KO
K07893  Ras-related protein Rab-6A
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    419063 (RAB6A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    419063 (RAB6A)
   04031 GTP-binding proteins [BR:gga04031]
    419063 (RAB6A)
Membrane trafficking [BR:gga04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    419063 (RAB6A)
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
    419063 (RAB6A)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   419063 (RAB6A)
  Exosomal proteins of bladder cancer cells
   419063 (RAB6A)
GTP-binding proteins [BR:gga04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    419063 (RAB6A)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA CPT TetR_C_16
Other DBs
NCBI-GeneID: 419063
NCBI-ProteinID: NP_001038105
CGNC: 50908
Ensembl: ENSGALG00000017320
UniProt: Q1KME6
Position
1
AA seq 208 aa
MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST
QDKSREDMIDIKLEKPQEQPVSEGGCSC
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtcggcgggcggggacttcggcaacccgctgcggaaattcaagctggtgttcctgggc
gagcagagcgtggggaagacttccttgatcaccaggttcatgtatgacagctttgacaac
acctaccaggcaacaattggcattgacttcttatcaaaaaccatgtatttggaggatcga
acaatcaggttgcagctgtgggatactgcgggtcaggaacgtttccgtagcctcattccc
agttacatccgtgactctgctgctgctgtagtagtttacgatatcacaaatgtcaactcg
ttccagcaaacaacaaaatggatcgacgatgtcagaacggaacggggcagcgatgtcatc
attatgctggtgggaaataaaacagatctagcagataagaggcaagtgtccattgaggaa
ggagaaagaaaagccaaagagctgaatgtaatgttcatcgaaactagtgcaaaagcagga
tacaatgtaaaacagcttttccgacgcgtggcagctgccttgcctggaatggaaagcaca
caagacaaaagtagagaagacatgattgacatcaaactggaaaagcctcaagagcagcct
gtcagtgaaggaggctgctcctgctaa

DBGET integrated database retrieval system