KEGG   Gallus gallus (chicken): 419083Help
Entry
419083            CDS       T01006                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04510  Focal adhesion
gga04625  C-type lectin receptor signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    419083 (PAK1)
   04012 ErbB signaling pathway
    419083 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    419083 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    419083 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    419083 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    419083 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    419083 (PAK1)
   03036 Chromosome and associated proteins [BR:gga03036]
    419083 (PAK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     419083 (PAK1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  STE20 family
   419083 (PAK1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    419083 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    419083 (PAK1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     419083 (PAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Motif
Other DBs
NCBI-GeneID: 419083
NCBI-ProteinID: NP_001155844
CGNC: 432
Ensembl: ENSGALG00000000681
UniProt: E1C3P6
Position
1
AA seq 544 aa AA seqDB search
MSNNGVETEDKPPAPPMRNTSTMIGSGSKDTGTLNHGSKPLPPNPEEKKKRDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKN
PQAVLDVLEFYNSKKTSSSQKYMSFTDKLAEEYNSSNTLNVKAVSETPAVPSVSEDEDDE
DDAAPPPVIAPRPEHTKSIYTRSVIDPLPPPTRDVATSPISSPSENSTAAPDMLIRNAEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIIAAKEAT
KNNH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaatggagttgaaacagaagacaaaccacctgctcctccgatgagaaacacc
agcactatgattggatcaggaagcaaagacaccgggactttaaaccatggctcaaaacct
ttgcctcccaacccagaagaaaagaagaagagggaccgattttaccgatctattttacca
ggagataaaaccaacaagaagaaagagaaggagcggccggagatctccctcccttctgac
tttgaacacacaattcatgtggggtttgatgcagtcactggagaattcacaggaatgccg
gagcaatgggcacgcttactacagacttccaacatcaccaaattagagcagaagaagaac
ccccaggcagtgctggacgtactggagttttacaactccaagaagacctccagcagccag
aagtacatgagtttcacagataagttggcagaggaatacaattcgtcaaatactctgaat
gtgaaagctgtgtctgagacccctgcagtgccctcagtgtctgaagatgaagatgatgaa
gatgatgcagctccaccccctgtgatagctccacgacctgaacacaccaaatctatatac
actcgctctgtgatagacccccttcctcctcctaccagagatgtggccacctctcctatt
tcttctccctcggaaaacagcacagcagcacccgacatgctgatcaggaatgcggagaaa
caaaagaaaaagccaaaaatgtcagatgaagagattctggaaaaattaagaagcatcgtg
agtgtgggtgatccaaaaaagaagtacacgcgttttgagaagattggacaaggagcctca
ggtacagtttacacagcaatggatgtagctacaggacaggaggttgcaatcaagcagatg
aatttgcagcagcagcccaaaaaggaattgattatcaatgaaatcctcgtaatgagggaa
aacaaaaaccccaacattgtcaactacttggacagttaccttgtaggagaagagctctgg
gtagtcatggagtacttggcaggaggctccctaacagatgtcgttacggagacctgcatg
gacgaaggacagattgcagctgtgtgccgagagtgtcttcaggctttggaattcctccac
tcaaaccaagttattcacagagacatcaagagtgacaacatcctactgggaatggatggc
tctgtcaaattaactgactttggcttctgtgcccagatcactcctgagcagagcaaacgc
agcaccatggtggggaccccatactggatggcacctgaagtggtgacacggaaagcatac
gggcccaaagtggacatctggtcgctggggataatggccatcgagatgattgaaggagaa
cccccctacctcaacgagaaccccctgagagcactgtatctcattgctaccaatgggact
ccagaactgcagaatccagaaaagctttcacccatattcagagacttcctaaaccgctgt
cttgaaatggatgtggaaaaaagaggttctgcaaaagagctgctacagcaccagttcctg
aaaatcgcaaagcctctttctagcctcactcctctaattattgctgccaaagaggcaaca
aagaacaaccattaa

DBGET integrated database retrieval system