KEGG   Gallus gallus (chicken): 419106
Entry
419106            CDS       T01006                                 

Gene name
GATA3
Definition
(RefSeq) GATA-binding factor 3
  KO
K17895  GATA-binding protein 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419106 (GATA3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    419106 (GATA3)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon ArfGap DZR_2 Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 419106
NCBI-ProteinID: NP_001008444
CGNC: 5080
Ensembl: ENSGALG00000029270
UniProt: P23825
Position
1
AA seq 444 aa
MEVSTDQPRWVSHHHPAVLNGQHPDSHHPTLGHTYMDPTQYPLAEEVDVLFNIDGQGNPV
PPYYGNSVRATVQRYPTAHHGSQVCRPPLLHGSLPWLDGSKALSSHHSASPWNLSPFSKT
SIHHSSPGPLSVYPPASSSTLSAGHSSPHLFTFPPTPPKDVSPDPSISTPGSTGSTRQDE
KECIKYQVSLADTMKLESSHSRSSMASLGGATSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDNLEDFPKSSSFNPAALSRHMSSISHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggtctccacggaccaaccgcggtgggtgagccaccaccacccggccgtgctcaat
gggcagcacccggactcccaccaccccactcttggccatacctacatggaccccacgcag
tatcctctcgccgaggaagtggatgtactttttaatatcgacggacaaggcaaccccgtg
cctccgtattacggcaactccgtgcgagccaccgtgcagcggtaccccacggcccatcac
ggcagccaggtgtgccggccccctctgctgcatggttcgctgccgtggctggacgggagc
aaagcgctgagcagccaccacagcgcttccccttggaacctcagccctttttccaagacc
tccatccatcacagctcgccgggacccctctccgtttacccgcctgcttcttcctccact
ttatccgccggtcactccagcccgcaccttttcaccttcccaccgacccctcctaaagat
gtgtccccggatccgtccatctccactcctggctccaccggctccacccggcaggatgag
aaggaatgcatcaaatatcaggtgtccctggctgacaccatgaagctggagtcgtctcac
tctaggagcagcatggcctcgttaggaggagccacctcctccgctcatcaccccatcact
acttacccaccgtatgtccccgaatatagctctggactttttccccccagcagcctctta
ggaggatcgcctaccgggttcgggtgcaaatcacgaccgaaagcgcggtcgagcacagaa
ggcagggagtgtgtaaattgtggggctacctcaacccctctgtggagaagagacggcacc
gggcactacttgtgtaacgcctgtggactctatcacaaaatgaatgggcagaaccgaccc
ctgattaaacccaagagaaggctgtctgcagccaggagggcgggcacgtcctgtgctaac
tgtcagaccaccaccaccaccctgtggaggagaaatgccaacggcgatcctgtctgtaat
gcctgtgggctctactacaagctgcacaatattaacagacccctgactatgaagaaagaa
ggaattcagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaggtccat
gacaaccttgaagactttcccaagagcagctcctttaaccccgccgccctctccagacac
atgtcctctatcagccacatttcacccttcagtcactccagccacatgctgactacaccg
acaccgatgcatcctccatccagcctctcctttggacctcaccatccctccagcatggtc
actgccatgggttag

DBGET integrated database retrieval system