KEGG   Gallus gallus (chicken): 419108
Entry
419108            CDS       T01006                                 

Gene name
ATP5F1C
Definition
(RefSeq) ATP synthase subunit gamma, mitochondrial isoform 1
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
gga  Gallus gallus (chicken)
Pathway
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
Module
gga_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    419108 (ATP5F1C)
SSDB
Motif
Pfam: ATP-synt WASH_WAHD
Other DBs
NCBI-GeneID: 419108
NCBI-ProteinID: NP_001265025
CGNC: 5096
Ensembl: ENSGALG00000006753
UniProt: A0A1L1RYK0
Position
1
AA seq 294 aa
MFARGSAVVLYQPQWGQVRNMATLKDITRRLKSIKNIQKITKSMKMVSAAKYARAERELK
PARVYGTGALALYEKAEIKAPEDKKKHLLIGVSSDRGLCGAIHTSIAKTLKNEITNLSNA
GKEVMVVGVGDKIRGLLQRTHGNYFLMTFKEVGRRPPSFGDASVIASELLNSGYEFDEGS
VIYNRFRSVISYKTDEKPIYSFETVAGSESLSIYDDIDADVLRNYQEFTLANILYYSLKE
STTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 885 nt   +upstreamnt  +downstreamnt
atgttcgctcggggctccgccgtggtgctgtaccagccgcaatggggccaagtcaggaat
atggcaactctgaaagacattaccaggcgtttgaagtccatcaagaacattcagaaaatt
acgaagtccatgaagatggtttctgcagcaaagtatgcaagagctgagagggagctgaag
cctgctagggtatacggaacaggagcactggcactgtatgagaaagcagaaattaaggca
cccgaggacaagaagaagcacctccttattggtgtgtcctctgatcgaggtctgtgtggt
gctatccatacatctattgctaaaaccttgaagaatgagattaccaacctctccaatgca
gggaaggaagttatggtggttggtgtaggtgacaagatcagaggcctacttcaaaggacg
catggcaattacttcctgatgacattcaaagaagtggggcggagacctcccagctttgga
gatgcttcagtcattgcttcagagttattaaactctgggtatgaatttgatgaaggctct
gtcatctacaatcggttcagatctgtcatctcctacaagactgatgaaaaacctatctac
tcttttgaaacagttgctggttctgaaagcctgagtatctatgatgacattgatgctgat
gtgctgagaaactaccaggaatttacactagcaaatattctgtactactccctgaaagaa
tctaccaccagtgagcagagtgcaaggatgactgctatggacaacgcaagcaaaaatgct
tctgagatgattgacaaactgactttgacattcaaccgtacccgtcaggctgttattact
aaggagcttattgagatcatctctggtgctgctgctctggattaa

DBGET integrated database retrieval system