KEGG   Gallus gallus (chicken): 419155
Entry
419155            CDS       T01006                                 

Gene name
CBFA2T2
Definition
(RefSeq) protein CBFA2T2
  KO
K22751  CBFA2/RUNX1 translocation partner 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    419155 (CBFA2T2)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Zinc finger domain-containing proteins
  MYND-type zinc finger domain-containing proteins
   419155 (CBFA2T2)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND Remorin_C
Other DBs
NCBI-GeneID: 419155
NCBI-ProteinID: NP_001011689
CGNC: 2242
Ensembl: ENSGALG00000003096
UniProt: Q5IJ73
Position
20
AA seq 584 aa
MVGISGGCQFAGEKRVPVMPGSPVEVKIQTRSSPPNMPPLPPVNPGGPRPVSFTPTALPN
GMNHSPPTLNGAPSPPQRFGNGPASSSSSSLTNQQLPATCGARQLSKLKRFLTTLQQFGN
DISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLH
CARAAKQTPSQYLAQHEHILLNTTSSPADSSELLIEVNGNGKRHSPDRRDDNSFEREPLP
TEPPAKRVCTISPAPRHSPALSIPMLNPGGQFHPTPPPLQHYTLEDIATSHLYRDPGKML
EHREIRDRHGGLGLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVL
RRCQEADREELNYWKRRCSEAEPRKAGGELGTARHSPGSSDSIGSDSLREFSSRSGPGYV
TEEIWKKAEEAVNEVKRQAMSEVQKAVAEAEQKAFEMIASERARMEQTIADAKRQATEDA
FLVINEQEESTESCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRICGQSLHGHSKG
LALPAGRSAKGMDGVPSPSMEKSSAATSRSSTPAFVTAIDTNGL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggtggggatctcgggaggctgccagtttgctggtgagaagagggtgccagtgatgccc
ggctcgcccgtggaagtgaagatacagaccaggtcctctcctcccaacatgccaccactg
ccccccgtcaaccccggcggcccccggcccgtctccttcaccccaactgcactgcccaac
gggatgaaccattcccccccaacgctcaacggggcaccgtccccaccccagcgctttggc
aacggcccggcctcctcctcctcttcctcactgaccaaccagcagctcccggccacgtgc
ggtgcgcggcagctcagcaagctgaaacgcttcctcaccaccctgcagcagtttggcaat
gacatctctccggagatcggggagaaggtgcggaccctggtcctggccctggtgaactca
acagtgacgattgaggaatttcactgcaagctgcaagaggcgacgaacttccccctgcgg
ccctttgtgatccccttcctgaaggccaacctccctctgctccagagagagctgctgcac
tgcgcccgggctgccaagcagacaccatcccagtacctggcccagcatgagcacatcctt
ctcaacaccacctcctccccagccgactcctcggagctgctcattgaggtcaacgggaac
ggcaagaggcacagccctgacagaagggatgataacagcttcgagagggagccgctgccg
acggagccgccggccaagcgtgtgtgcaccatcagccctgcgccccggcacagcccagca
ctcagcatcccaatgctgaaccccggcgggcagttccaccccaccccaccacccctccag
cactacaccctggaagacatcgccacctcccatctgtacagagaccccggcaagatgctg
gagcacagggagatccgggacaggcacggcgggctcggtttgaatggaggttaccaggat
gagttggtggaccaccgcctgacagagagggagtgggctgacgagtggaagcacctcgat
catgctctgaactgcatcatggagatggtggagaagacccggcgctccatggccgtgctg
cggcgctgccaggaggccgaccgtgaggagctcaactactggaagaggcggtgcagtgag
gctgagccccgcaaggcggggggggagttgggcacagcccggcacagccccggcagctcc
gactccatcggcagcgattcactgcgggagttcagcagcaggtcggggccgggctacgtc
actgaggagatatggaagaaagcagaagaagccgtgaacgaggtgaagcgccaggccatg
tcggaggtgcagaaggccgtggcagaggcagagcagaaggcgtttgagatgatcgcctcc
gagagggcgcgcatggagcagaccatcgccgacgccaagcgtcaggccaccgaggatgct
ttcctggtgatcaacgagcaggaggagtccacggagagctgctggaactgcggccgtaag
gccagtgagacgtgcagcggctgcaacatcgcgcgctactgcggctccttctgccagcac
aaggactgggagaggcaccaccgcatctgcgggcagagcctgcacggccacagcaagggg
ctggcactgcctgcggggcgctcggccaagggcatggatggcgtgcccagccccagcatg
gagaagagctcggcagccacctcccgctcctccacgcccgcatttgtgacagcgatagac
acgaacggactctaa

DBGET integrated database retrieval system