KEGG   Gallus gallus (chicken): 419160
Entry
419160            CDS       T01006                                 

Symbol
PTPRT
Name
(RefSeq) receptor-type tyrosine-protein phosphatase T isoform X1
  KO
K13297  receptor-type tyrosine-protein phosphatase T [EC:3.1.3.48]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    419160 (PTPRT)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     419160 (PTPRT)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    419160 (PTPRT)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 DSPc Y_phosphatase3 PTPlike_phytase PTP_tm Ig_2 I-set ig
Other DBs
NCBI-GeneID: 419160
NCBI-ProteinID: XP_004947043
CGNC: 2545
Ensembl: ENSGALG00000037889
Position
20
AA seq 1510 aa
MTGFAAIVLLLRLLHEADGQAFPGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPTMD
PAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYLSSRDRSSPGSLNVYVKV
NGGPQGNPIWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLA
HPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHR
RFSATVSVADTSQRSISKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAVGATYLW
IKPNANSIIGDGPIILKEVEYRTTTGNWAETHIVDSPNYKLWHLDPDVEYEIRVLLTRPG
EGGTGPPGPPLTTRTKCADPVHGPQNVEVVDIRSRQLTLQWEPFGYAVTRCHSYNLTVQY
QYVFNQQKFEAEELIQTSSHYTLRGLRPFMTIRLRLALSNPEGKMESEELVVQTEEDVPG
PVPLESIQGGPFEEKIYVQWKPPNETNGIITLYEITYKAVGSLDPSADLSSQRGKVFKLR
NETHHLFVGLYPGTTYSFTIKASTVKGFGPPITTRIATKISAPSMPEYDTDSPLNETDTT
ITVMLKPAQSRGAPVSVYQLVVKEEKLQKARRAADIIECFSIPVSYKNASSLDSPHYFAA
ELKPINLPVTQPFTVGDNKTYNGYWNAPLSPLKSYSIYFQALSKANGETKINCVRLATKA
VLGRQQATTRNPPGLLSTGASTQNSNAVEPEKQVDSTVKMAGVIAGLLMFVIILLGAMLT
IKRRRNAYSYSYYLHSSQCFRGLSVFYRTRKLAKKQKETQTSTQREMGPVAASDKASAKL
SAVHNEEAFSSSCQDVNGFTSPSPCSFSVQSKTLQSKSLLNSYYSVSSDTVPSTTLLGKT
DSSHGEMTQPTLTIQTHPYRSCEPVEMSYPRGQFQPAIRVADLLQHITQMKRGQGYGFKE
EYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLQLLDGDPHSDYINANYIDGY
HRPRHYIATQGPMQETVKDFWRMIWQENSASVVMVTNLVEVGRVKCVRYWPDDTEVYGDI
KVTLIETEPLAEYVIRTFTVQKKGYHEIREIRQFHFTSWPDHGVPCYATGLLGFVRQVKF
LNPPEAGPIVVHCSAGAGRTGCFIAIDIMLDMAENEGVVDIFNCVRELRSQRVNLVQTEE
QYVFVHDAILEACLCGNTAIPVCEFRSIYYNISRIDPQTNSSQIKDEFQTLNIVTPRVRP
EDCSIGLLPRNHDKNRCMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFIVTQH
PLPNTVADFWRLVFDYNCSSVVMLNEMDAAQLCMQYWPEKTSCCYGPIQVEFVSADIDED
IINRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGRD
GRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVESLEQYKFVY
EVALEYLSSF
NT seq 4533 nt   +upstreamnt  +downstreamnt
atgaccggcttcgccgcgatcgtcttgctcctgcggcttttgcacgaggcggacggacag
gctttcccaggtggttgttcatttgatgagcactacagtaattgtggttacagtgtggcc
ttgggaaccaatggatttacctgggagcagatcaatacctgggaaaagccaacgatggat
cctgcagtcccaactggctccttcatgatggtgaacagctctggacgggcatccgggcag
aaagctcacttacttttgcccacgttgaaggaaaatgacacacattgcatcgacttccat
tattacttatccagcagagatcgctcgagtcctggctctctgaatgtctacgtgaaagtg
aatggaggaccacagggcaatcccatatggaatgtctcaggggttgttacagaaggatgg
gtgaaggcagaacttgccatcagtacgttctggccacatttttatcaggtgatatttgaa
tccgtctctttgaaaggacacccagggtacatagctgtggatgaagtcagagttcttgcc
catccatgcagaaaagcacctcatttcttacggcttcagaatgtggaggttaatgtggga
cagaatgcgacattccagtgcattgccggggggaagtggtcccagcatgacaaactctgg
ctccagcagtggaatgggagggacacggcattaatggtcactcgagtcgtcaaccacagg
cgtttctccgccaccgtcagcgttgctgacacctcgcagcgcagtatcagcaagtaccga
tgtgtcatccgctccgatggtgggtctggagtttcgaattatgcagaattaatagtgaaa
gaacccccaactcctattgcccctcctgagctactggctgttggagccacctacctgtgg
atcaaacccaacgccaactccatcattggagatgggcccatcatactgaaagaggtggag
tatcggacgaccactgggaactgggcagaaacacacattgtagactctcccaattacaaa
ctgtggcatctggatccagatgtggagtatgagatcagagtgctgctgactcgcccagga
gaaggaggcacaggaccacctggaccaccactcacaacaaggacaaaatgtgcagatcct
gtccatggaccacagaatgtagaagtggttgatatccgttcccggcagctgacattgcag
tgggagccctttggttatgcggtgacccgctgccacagctacaatctcacagtgcagtac
cagtatgtctttaaccagcaaaaatttgaggcagaggaactcatccaaacttcttcccac
tacaccttgcgaggtcttcggcccttcatgaccatcaggctgaggctggccctttctaat
ccagagggcaaaatggagagtgaggagctagttgtgcagactgaggaggatgttcctgga
cctgttcccttggaatccatccagggaggaccttttgaagagaagatctatgttcagtgg
aagcctccaaatgagacaaatggcatcattacactttatgagattacttacaaggccgtt
gggtctctggatcccagtgctgacctgtccagccaaagagggaaagtcttcaaactaagg
aatgaaacgcatcacctctttgtaggattatacccagggactacgtattcattcaccatc
aaagccagcactgtgaagggctttgggccacccatcacaacacggattgcaactaagatt
tcagcgccgtcaatgccggagtacgacacggactcacccttgaatgagactgacaccacc
atcactgtcatgctgaagcctgctcagtcccggggagcccctgtcagtgtctatcaactc
gttgtcaaggaggagaagctacagaaagctcgcagagctgcagacatcattgaatgcttc
tccatcccagtgagctacaagaacgcctccagccttgactcaccccactactttgcagct
gagctgaagcccatcaatctgcccgtcacacagcccttcaccgtgggtgacaacaagacc
tacaatggctactggaatgctcctctttctcccctgaaaagctacagcatatacttccag
gctcttagcaaggcaaacggcgaaacaaaaatcaactgtgtccggctggcgactaaagca
gtgctgggtaggcaacaggcgaccacacgaaacccacccggcctcctgagcacaggagct
tccacccagaattccaatgcagtggaaccagaaaagcaagttgacagcacagtgaaaatg
gctggagttatagctgggcttctgatgtttgttattattctcttaggagcaatgcttacc
atcaagagaagaagaaatgcatactcctactcctattacttgcattcaagccaatgtttt
aggggcctctctgtcttctacaggaccaggaagctagccaagaagcagaaggagactcag
accagcacacagagagagatgggtcctgtggccgcttcagacaaggcctctgccaaactc
agcgctgttcacaatgaagaagctttctcttccagctgccaagatgttaatggattcaca
tcaccctctccttgttcattttctgtccaaagcaaaacccttcagagcaaatctttgttg
aattcctactactcagtatcatcagacacagttccatcgaccacgctgttaggtaagaca
gacagtagccacggagagatgacccagccaaccttgactatccagacccacccgtaccgg
agctgtgagccagtggaaatgtcctacccacgggggcagttccagccagccatccgagtg
gccgacctgctgcagcacatcacccagatgaagcgtggacagggctatggatttaaagag
gagtatgaggcactacccgaggggcagacggcatcctgggatacagccaaggaagatgaa
aatcgcaataagaatagatatggaaacataatctcctatgatcattcaagagtgagattg
cagctgctggatggggaccctcactctgactacatcaacgccaattacatagatggatac
caccggcctcgtcattacattgcaactcaagggccgatgcaagagacggtgaaggatttc
tggagaatgatttggcaagaaaactctgcaagcgttgtcatggtcaccaacttggtggaa
gtgggcagggtgaagtgtgttcgatactggccagatgacacagaggtctatggggatatt
aaagtcacattaattgagacagaaccactggcagagtatgtcatacgcacatttactgta
caaaagaaaggctaccatgagatccgagagattcggcagttccacttcaccagctggccg
gaccacggggttccttgctatgccacgggcctcctgggctttgttcggcaagtgaagttc
ctcaacccccctgaggcaggacccatcgttgtgcactgcagtgctggggccgggaggaca
gggtgctttattgccattgacatcatgcttgacatggcagagaacgaaggtgtggtcgat
atatttaactgcgtgcgagagctgcgctcccagagggtcaatttggtgcagacagaggaa
cagtatgtatttgtccatgatgccattttggaggcatgtctctgcggcaacacggccatt
ccagtttgtgagttcagatccatatattacaacatcagcaggatagatccacagaccaat
tccagccagataaaagatgagtttcagactctcaacattgtgacgccacgggttcgacca
gaggactgcagcatcggccttttgccgaggaaccatgacaagaaccgctgcatggatgtg
ctgcccttggaccggtgcctgcccttcctcatctctgtggatggtgaatccagtaactac
atcaatgctgcgctcatggatagccacaagcaacctgctgcctttattgtaacccagcac
cctttgcccaacaccgtagcagacttctggaggctggtgtttgattataactgctcctcc
gtagtgatgctgaatgagatggatgctgcacagctctgcatgcagtactggccagagaag
acgtcctgttgctatggcccaattcaagtagagtttgtttcagcagacatcgatgaagac
atcatcaaccggatattccggatctgcaacatggccaggccccaggatggctatcgcata
gttcagcacctgcagtacatcggctggccagcgtaccgggacacccctccgtccaagcgc
tcgctgctgaaggtggtcaggaggctggagaagtggcaggagcagtacgatgggagagac
ggccgcactgtggtccactgcctgaacggtgggggacgcagtggcaccttctgtgccatc
tgcagtgtgtgtgaaatgattcaacagcaaaatatcatcgacgtgttccacatagtgaaa
acgttacggaataacaagtccaacatggtggagtcgctggaacagtataaatttgtatat
gaggttgcactggaatacttgagctccttttag

DBGET integrated database retrieval system