KEGG   Gallus gallus (chicken): 419198Help
Entry
419198            CDS       T01006                                 

Gene name
HNF4A
Definition
(RefSeq) hepatocyte nuclear factor 4-alpha
  KO
K07292  hepatocyte nuclear factor 4-alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419198 (HNF4A)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:gga03310]
    419198 (HNF4A)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    419198 (HNF4A)
Nuclear receptors [BR:gga03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   419198 (HNF4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 419198
NCBI-ProteinID: NP_001026026
CGNC: 50941
Ensembl: ENSGALG00000004285
UniProt: Q5ILH0
Position
20
AA seq 454 aa AA seqDB search
MEMADYSAALDPAYTTLEFENMQVLAMGSDTSPSEAANLNTSNSIGVSALCAICGDRATG
KHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCVVDKDKRNQCRYCRLKKCFRAGMKKEA
VQNERDRISTRRSSYEDSSLPSINVLLQAEVLAQQISSPVLVMNGDIRGKKIANIADVCE
SMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGVAKRSMVFKDVLLLGNDH
IVPRNCPELVEVRVAIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPSKIKR
MRYQVQVSLEDYINDRQYDSRGRFGELLLLLPVLQSITWQMIEQIQFVKLFGMAKIDNLL
QEMLLGGSSSETPHAHHPLHPHLIQENLGTNVIVANTMPPQMHNGQMSTPETPQPSPPAG
SGPEQYKLLPGAIATVAKQPTSIPQPAITKQEVI
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggagatggccgattatagcgcggcgctggacccggcgtacaccaccctggagtttgag
aacatgcaggtgctggccatgggcagcgacacatctccatcagaagcagccaacctcaac
acctccaacagcatcggggtgagcgcactgtgtgccatctgtggggaccgtgccacaggg
aagcactacggggcttccagctgcgatggctgcaaaggcttcttcaggaggagcgtgagg
aagaaccacatgtactcctgcaggtttaacaggcagtgtgtggtagacaaagacaaaaga
aaccagtgccgatactgcaggcttaagaagtgcttccgagcagggatgaagaaggaagct
gtacaaaatgaacgggaccgaatcagcacccgaagatcaagttacgaagacagcagcttg
ccctccatcaatgtcttactgcaggcagaagtcctggcacaacagatatcatccccagtc
ctcgtgatgaacggagacatccgagggaagaagattgccaacatcgccgacgtgtgcgag
tccatgaagcagcagctgctggtgctggtggagtgggccaagtacatccctgcgttctgc
gagctgcccctggacgaccaggtggcactgctgcgggcacatgcaggtgaacatctgtta
ctgggagttgccaagaggtccatggtgttcaaggatgtcttgctgctagggaacgaccac
atcgtccctcggaactgccccgagctggtagaggtgcgcgtggccatccgcatcctggat
gagctggtcctccccttccaggagctgcagatagacgacaatgaatacgcctgcttgaaa
gccatcatcttcttcgacccagatgccaaaggactgagcgatccctccaagatcaagcgg
atgcggtaccaggtgcaggtcagcctggaggactacatcaatgacaggcagtacgactcg
cggggccgcttcggggagctgctgctgctgctgcctgtgctgcagagcatcacctggcag
atgatagagcagatccagtttgtcaagctcttcggcatggctaagatcgacaacctgctg
caggagatgctgctgggaggttcatcaagtgaaacgccacatgctcaccaccccttgcat
cctcatctgatccaggagaacctgggaacaaacgtcattgtggccaacacaatgcctcct
cagatgcacaacgggcagatgtctactccagaaactcctcagccatctcctcctgcaggt
tcagggccggagcagtacaaactgctgcccggagccattgcaaccgtggcaaaacagccc
acctccatcccacagcctgccatcacaaagcaggaggtcatctag

DBGET integrated database retrieval system