KEGG   Gallus gallus (chicken): 419205
Entry
419205            CDS       T01006                                 

Symbol
OCSTAMP
Name
(RefSeq) osteoclast stimulatory transmembrane protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: DC_STAMP
Other DBs
NCBI-GeneID: 419205
NCBI-ProteinID: XP_015152206
CGNC: 3192
Position
20:complement(5539382..5548821)
AA seq 458 aa
MGSLRTGLGHISFFRVRDNAYCEDSLFSKVHRIMSEQWSIYSKPVPADSRELWALFLQCS
CITVLLGGLFYNWLLASLEYPWHVSVAMAVTFSLLLLLALFLVHPVRCAFSIAMPTLGTK
QGRKLLLSTCIMIAVVNITPNIISNIKTLLKVILCISKNSSESLLNSTDLLGNTFWKLEH
ELQNYLIWKPMDGHIQFSLVKNSSLINQVHLAGEKARKDFLAVEVLVKDCVRAGNKLVAA
FSVLYLCFESIWYLKNYLTNLCFDNVYITKKLRHLAEDKGASHLLVGSAPRLIRPTGLRL
SREELMLCLAQALRLSVALLLVLVMVALEHLVFGVADVAVRRMAQLSTVPVTLSIKYQAG
IDFLKIPFPVRDINRSYHRALTFSSASCSISPPVPPNPSVLLVVGLLFCIIYATMFLETY
ARRLCRKIAASFFESREDERAHYLYGKLSRQHRETQCS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggggagcctacggacaggactgggacacatctcgtttttcagagtgcgtgacaacgcc
tactgtgaagactccctgttctcaaaggtgcacaggatcatgtcagagcaatggtccata
tactccaaaccagtcccagcagacagccgggagctgtgggccctatttctgcagtgctcc
tgcatcactgtgctgctcggaggcctcttctacaactggctccttgcatccctggagtac
ccctggcacgtctccgtcgcgatggccgtcaccttcagcctgctcctcctcctcgccctg
ttcttggtgcaccctgtgcgctgtgccttcagcatcgccatgccaacgctgggcaccaag
cagggccggaagctcctcttgtcgacctgcatcatgatagcagtggttaacatcaccccc
aacatcatcagcaacatcaagaccttactgaaggtcatcctgtgcatctccaagaattcc
tctgagagccttttgaactccacagatctgctggggaacactttctggaagctggagcat
gaattacagaattaccttatttggaagcccatggatggacacattcagttctcactggtg
aagaacagctccttgattaaccaggtgcacctcgctggtgagaaagccaggaaggacttt
ttggctgtcgaggtgctggtcaaagattgcgtgcgagcaggcaacaaactggtcgctgcc
ttctccgtgctctacctctgctttgagtccatttggtacttgaagaattacctcaccaac
ctctgcttcgacaacgtttacatcaccaagaagctgcggcatttggctgaggacaaagga
gcctcccacttgttggtgggctcagccccacgcctcatccgccccacgggcctccggctg
tcccgcgaggagctgatgctgtgcctggcgcaggcgctgcgcctctcggtggccctgctg
ctggtgctggtgatggtggccttggagcacctcgtctttggcgtagcggatgtggcggtg
aggaggatggctcagctctccacagtgcccgtcacgctcagcatcaaataccaggctgga
atagacttcttgaaaatcccatttcccgtgagggacattaataggagctaccaccgcgcc
ctgaccttcagctctgccagctgcagcatcagccccccggtacctcccaacccctccgtg
ctgctggttgtggggctgctcttctgcattatctatgccaccatgtttctggaaacctac
gcacgccgcctgtgcaggaaaattgctgcttccttctttgagagccgggaggacgagagg
gcacattacctctacggcaagctgtcccggcagcacagggaaacacaatgcagctga

DBGET integrated database retrieval system