KEGG   Gallus gallus (chicken): 419210
Entry
419210            CDS       T01006                                 

Gene name
PREX1
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein isoform X1
  KO
K12365  phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchanger 1 protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: RhoGEF DEP PDZ PDZ_6 PH PH_10 UPF1_Zn_bind Mrpl_C
Other DBs
NCBI-GeneID: 419210
NCBI-ProteinID: XP_015152177
CGNC: 50944
Ensembl: ENSGALG00000004621
UniProt: F1NK47
Position
20
AA seq 1656 aa
MEAPPPPPPPGAPSASEPAGCPKDADRQLRLRLCVLNEILSTERDYVGTLHFLQSAFLHR
IRQNAVDKAEKYITEENVKILFSNIEDILGVHKEFLAALEFCLQPEPQSQHELGNVFLKF
KDKFFVYEEYCSNHEKALRLLMELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLTPIQR
ICKYPLLLKELAKRTPSKHPDHPAVQNALQAMKTVCTNINETKRQMEKLEALEQLQSHIE
GWEGSNLTDICTQLLLQGTLLKISAGNIQERMFFLFDNLLVYCKRKSRVAGKKPSKRTKS
INGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAED
KQKWLDAIIKEREQRESLKLGMERDAYVMIAEKGEKLYQMMMSKKVNLIKDRRRKLSTVP
KCFLGNEFVSWLTDIGEISKPEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRYDDG
TYKPRSELEDIVSKGVRLYCRLHCLYTPVVKDRDYHLKTYKSVIPASKLVDWLIAQGDCQ
TREEAVALGVGLCNNGFMHHVLEKSEFKDESLYFRFYADEEMEGTSSKSKQLRNDFKLVE
NILGKGLLILPEEDDYGFDVEEKNKAIVVKSVRRGSSAEMAGLQAGRKIYSINEDLVFLR
PFTEVETILNQSFSSRRPLRLLVAIKSKEIIKIPDCPEALCFQIRGAAPPYVHAVGRGSE
AAAVGLHPGQCILKVNGSNASHGNYLDVLEHFTAYRTKQQEVLGLYQWVYRTHEDAEEDR
VQQAASNAYLNGSHPGSNKEDSSLTGDEDLDPLQNTHQESAQVQQTISSPPITGEETPLI
SLTVDNTHLEHGVVYEYVSSAGIKSFVLEKIVEPKGCFCLTAKILEAFAAEDNHFVRNCK
RLISLSSAVATMPQYEFRQICDTKLESISRRLANYQEFADGLKTKVSPAFKQAIMEPHSL
NSMDFCPTNCHINLMEVSYPKNTTSAGRSFSIRIGRKPSIIGLDPEQVGTVNPVSYTQHC
ITTMAAPSWRCLTPEDGDLDGSFGQQNGGTSQEERGLSFLLKQEDREIQDSYLHLFNKLD
IAVKEMKQYVVQINKLLSTITEPTEGGACEPPSTEESSPPSLGTEESDPDKAEHGGIKKV
CFKVSEEDQEDSGHDTMSFRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPSD
MRIPLDKQDKLHGCLEHLFNQVDAINALLKGPIITKAFEETKHFPMDHSLQEFKQKEETT
VRCRNNIQASIQEDPWNLPLRIKNLVEIIQKYVEDGKNQLLLALLKCTDTELQLRRDSIF
CQSLVAAICTFSEQLLAALNYRYNNNGEYEESSRDASRKWLEQIAATGVLLNYQSLLSPT
VKEERIMLEDIQVTLTELDKVAFYFKQLDESLGANTHVFYHIEGSRQALKVIFYLDSYYF
SKLPSRFQNGGSLKLHTVLFTKALESMDGQSQPAGLTLEELPQQINGLSLEKVQQYYRKL
RTFYLERSNLPTDSNTTAVKIDQLIRPITAMDELCRLMKSFINTKPTSSGYSSSNTSGAG
LLPISSELCYRLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQ
GPRVEISAKNLKVMDQMPQCAPRLYRLCQPPTDGDL
NT seq 4971 nt   +upstreamnt  +downstreamnt
atggaggctccgccgcctccaccgccgcccggcgcccccagcgcctcggagcccgcgggc
tgccccaaggacgcggaccgccagctgcgcctccgcctctgcgtcctcaacgagatcctc
agcaccgagcgggactacgtggggaccctccacttcctgcagtcggcatttcttcatcgg
atccgccagaatgctgtggacaaagccgagaagtacataacggaggagaatgttaagatc
ttattttccaacattgaagacattcttggtgttcacaaggagttcctggctgccctggaa
ttttgtttacaaccagaacctcagtctcagcatgaactgggaaatgttttcttaaaattt
aaagacaagttctttgtgtacgaggagtattgtagcaaccatgagaaagcgctcagactg
ctgatggaattgaacaagatcccaacagtgagagcattcctcctgagttgcatgcttttg
ggaggcagaaagactacagacataccactggaaggttatctactgactccaattcagaga
atttgtaaatatccacttctgcttaaggaactggctaagaggactccctctaagcatcct
gatcacccagctgtccagaatgcactgcaggcaatgaaaacagtctgcacaaatatcaac
gagaccaagagacagatggagaaactggaagcccttgaacagttgcagtcccacattgaa
ggatgggaggggtcaaatctgacagatatctgcacacagctcttgctccaaggaactttg
ttaaaaatttcagcaggaaatatccaggagagaatgttctttctattcgataatttactg
gtctattgcaagaggaaatccagagttgctgggaaaaaaccatctaaacggacaaaatca
atcaatggatccctttatatcttcagaggtcgaataaatacagaagtcatggaggtggag
aatgtggaagatggaacagcagattaccacagcaacggttacacagtgacaaatggctgg
aagatacacaacacagccaaaaacaagtggtttgtctgtatggccaagactgcggaggac
aaacagaaatggctggatgctataatcaaggaaagagaacagagagagagtttgaaactg
ggaatggagagggatgcgtacgtcatgattgcagagaaaggagagaagctgtaccaaatg
atgatgagcaagaaagtgaaccttatcaaagacaggaggagaaaattaagtactgttccc
aagtgctttcttggcaatgagtttgtatcatggctcacagacattggggagataagcaaa
ccagaggaaggggtcaacctgggacaggcactgttggaaaatggaattattcatcatgtt
tcagataagcaccagtttaagaatgaacaggtgatgtacagatttcgctatgatgatgga
acctataagccaagaagtgaattggaggacattgtgtccaagggtgttagactctactgc
cgactacactgcctgtatactccagtggtaaaagaccgtgactatcacctaaagacctac
aaatcagtaatacctgcaagtaagctagtggattggcttattgcacagggagactgtcag
actcgtgaggaagctgttgcactgggtgttggactctgcaataatggtttcatgcatcat
gtcctggagaaaagtgaatttaaggatgaatccttatatttccgcttttatgctgatgaa
gagatggaaggcaccagttccaagagcaaacaattacgtaatgactttaagcttgtggaa
aacatcttgggaaagggtcttctgattttacctgaggaagatgactatggatttgacgta
gaagaaaagaacaaagcaattgtggtgaagtcagttcgaagagggtcttctgcagagatg
gctggcctgcaggcaggaaggaaaatctattccatcaatgaggacttagtcttcctacgc
ccgtttacagaagtggaaaccattttaaaccagtccttcagctcacgaaggccacttagg
cttctggtagccatcaaatcaaaagagatcattaaaatcccagattgtcctgaagcactt
tgctttcagatacggggagcagcaccaccatatgttcatgcggtaggaagaggttctgag
gctgcagctgtaggccttcatccaggacaatgcattctgaaagtcaatgggagtaatgca
tcacatggaaattatctggatgttctggagcactttacagcatacaggaccaaacaacag
gaagtgttgggattgtaccagtgggtgtacagaacacatgaagatgctgaagaggacaga
gttcagcaagcagcatccaatgcgtatctgaatggaagtcatccagggtccaacaaagaa
gactcttcactgacaggagatgaagatctggatccacttcaaaatacccaccaggaatca
gcccaggtacagcagaccatcagctctccaccgataactggcgaagaaacacctctcatt
agcctgactgtggataacacccacctggagcatggggtggtatacgaatatgtcagcagt
gcaggaatcaaatcctttgtcctagagaaaattgtggaaccaaaaggttgcttctgtctc
acagcaaagattttagaggcctttgctgcagaagacaaccactttgtaaggaattgcaaa
aggcttatatccctgagcagtgctgtggccaccatgccccagtatgagttccggcagatc
tgtgacactaagctggaaagcattagcaggcggcttgcaaactaccaagagtttgcagat
ggattaaagaccaaggtgagcccagccttcaaacaagccatcatggaaccacattctctc
aacagcatggatttctgccccaccaactgccatattaacctcatggaggtgtcatacccc
aaaaacactacctcagcagggaggtcgttcagcattcgcattggacgaaaaccctctatt
attggtcttgatccagaacaagtaggtaccgtaaatccagtctcatatactcaacactgc
atcaccactatggctgcaccatcctggagatgtctgaccccagaagatggagatctcgat
ggtagttttggccagcagaatggaggaacaagtcaggaagaaaggggactcagctttctg
ctcaaacaggaagatcgagaaatacaggactcatacttgcacctttttaacaaacttgac
attgcagtgaaggaaatgaagcaatacgtcgttcagataaataaacttctgtccaccata
acagaacctacagaaggtggtgcctgtgagccaccatccactgaggagtcgtctccacct
tccctgggaacagaagagagtgatcctgacaaagctgagcatggtggcatcaagaaggtc
tgtttcaaagtttctgaggaggaccaggaagactctggacatgacacaatgagtttcaga
gactcctacagtgaatgtaacagtaaccgggattcagtgttgtcttacaccagtgtacgg
agtaatagctcttacttgggcagtgatgagatgggatcaggagatgagcttcccagtgat
atgaggattcctttagacaaacaagacaaacttcatggctgcctggagcatctttttaac
caggttgatgcaattaatgcacttctaaaaggaccaataataactaaagcctttgaagaa
accaagcactttccaatggaccacagcttgcaagaatttaaacagaaggaagaaaccaca
gtgaggtgccggaataatattcaagccagcattcaagaagatccatggaaccttccgttg
cgcatcaaaaacctcgttgaaatcatacaaaaatatgtggaagatgggaagaatcaactg
cttctggccttgttaaaatgcacggatactgagctacagctgaggagagattctatcttc
tgccagtctcttgtggctgctatttgcaccttttcagagcagttactggctgcgctcaac
tatcgatacaacaacaatggggaatatgaagagagcagcagagacgccagcagaaaatgg
ctggaacagatagcagccactggtgttttattaaactaccagtccctgctctcccctact
gtgaaggaggagcgcatcatgctggaagacatccaggtcactctgacagaactggacaaa
gttgccttctatttcaagcagctggatgaaagtcttggagcaaatactcatgttttctac
cacattgagggaagtcgtcaggccttgaaggttatcttttatcttgacagctactacttc
tccaaactgccttctcggtttcagaatggaggaagcttgaaactacacacggtgctattt
acaaaagctctagagagtatggatgggcaatcacaaccagctggcttaactctagaagaa
cttccacagcaaattaatggtctctctcttgaaaaagtgcagcaatactaccgtaaactc
aggacattttatctagagaggtcaaacttgcccactgattctaatactaccgcagtgaag
attgaccagctcattcgtcccattactgcaatggatgagctttgcaggctgatgaaatct
ttcattaacacaaaaccaacctcatcaggatactccagcagtaacacatcaggagctggc
ctgctacctatatcctctgagctctgttaccgacttggagcctgtcagattaccatgtgt
ggcactgggatgcagagaagtacattaagtgtgtccctggagcaagcagccatactggct
cgaagtcatggacttttgcccaagtgtatcatgcaagctacagacatcatgcgaaaacaa
ggaccaagggttgaaatctctgccaagaatctgaaagtgatggaccaaatgcctcagtgt
gcacctcgactctacaggctgtgccagccacctacagatggggatttataa

DBGET integrated database retrieval system