KEGG   Gallus gallus (chicken): 419212
Entry
419212            CDS       T01006                                 

Gene name
CSE1L
Definition
(RefSeq) exportin-2
  KO
K18423  exportin-2 (importin alpha re-exporter)
Organism
gga  Gallus gallus (chicken)
Pathway
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    419212 (CSE1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    419212 (CSE1L)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    419212 (CSE1L)
SSDB
Motif
Pfam: CAS_CSE1 Cse1 IBN_N Xpo1 DUF3385
Other DBs
NCBI-GeneID: 419212
NCBI-ProteinID: XP_015152176
CGNC: 3489
Ensembl: ENSGALG00000004707
UniProt: E1BV44
Position
20
AA seq 971 aa
MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLETVEGSQNYPLLLLTLLEKSQENVIKV
CASVTFKNYIKRNWRIVEDEPNKIFESDRIAIKANIVPLMLSSPEQIQKQLSDAISIIGR
EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAF
ALPLTNLFKATIDLCSTHANDASALKVLFSSLILIAKLFYSLNFQDLPEFFEDNMETWMT
NFHSLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQPYLPRFVTAIWNL
LVTTGQEVKYDLLVSNAIQFLASVCERPHYKHLFEDQNTLTSICEKVIVPNMEFRAADEE
AFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP
SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHIQPDLKSASVNEFPVL
KADGIKYIMIFRNQVPKEQLLLSIPLLINHLQAESIVVHTYAAHALERLFTMRGTNNTTL
ITAAEMAPFVEVLLTNLFKALTLPGSSENEYIMKAIMRSFSLLQESIIPYIPSVITQLTQ
KLLAVSKNPSKPHFNHYMFESICLSIRITCKANPDAVGSFEEALFMVFTEILQNDVQEFI
PYVFQVMSLLLEMHKNEIPSSYMALFPHLLQPVLWERTGNIPPLVRLLQAYLERGANTIA
SAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQN
SKTTKFIKSFLVFINLYCVKYGALALQEIFDSIQPKMFGMVLEKIIIPEIQKVSGQVEKK
ICAVGITKILTECPPMMDTEYTKLWTPLLQALIGLFELPEDDTIPDEEHFIDIEDTPGYQ
TAFSQLAFAGKKEHDPVGQMVNNPRIHLAQSLHKLSTACPGRVPSMLSTSLNAEALQYLQ
GYLQAASVTLL
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggagctgagcgatgccaatttacagaccttaactgagtacctaaagaaaacactggat
ccagatcctgcaataaggcgtcctgcggagaagtttcttgagacagttgaaggaagccag
aattatccattgctgctcttaacgctgctggagaaatcgcaggaaaatgtcatcaaagtc
tgcgcgtcggtaacattcaagaattacatcaaaaggaactggagaattgtggaggatgaa
ccgaacaaaatatttgaatcagacaggatagccattaaagccaacatagtgcccttgatg
cttagcagcccggaacaaattcaaaagcagttaagtgatgccatcagtattattggccgg
gaagactttcctcagaagtggccagacttgctgacagaaatggtgaaccgctttcaaagt
ggagacttccatgtcattaatggcgtccttcgtactgctcactctttgtttaaaaggtac
cgccatgaatttaagtcaaatgaattatggacagagatcaaacttgtccttgatgccttt
gcattgcccttgacaaatctctttaaggcaactattgacctttgcagcacgcatgcaaac
gatgctagtgctttgaaggttctcttttcttctctcattctaattgcgaagctgttctac
agtttaaattttcaggatttgcctgagttttttgaagataacatggaaacgtggatgaca
aattttcatagtctcttaactttagataataaacttctgcagactgatgatgaagaagaa
gccggcttactggagctcttgaaatctcagatttgtgataatgctgctctatatgctcaa
aaatatgacgaagaattccagccctacttgccacgttttgtgacagcaatctggaatctg
ttagtcacaacaggtcaggaagtgaaatatgatttgttggttagtaatgcaatccagttt
ctggcctcggtttgtgaaagaccacattacaagcatctgttcgaagaccagaatacgttg
acaagcatctgtgaaaaagttattgttcctaacatggaatttagagctgctgatgaagaa
gcatttgaagataattctgaagaatatataagaagggatttggaaggatctgatattgac
acaaggcgcagagcagcttgtgatctggtcagaggcttgtgcaagttctttgaagggcct
gtgacaggaattttttctggatacgttaattccatgcttcaggaatatgcaaagaatcca
tctgttaactggaagcacaaagatgcagctatataccttgttacatcgttggcatccaag
gctcagacacagaagcatggaataacacaagccaatgaacttgttaatctgacagaattc
tttgtgaatcacattcagcctgacttaaagtcagctagtgtgaatgaatttccagtgcta
aaagctgatggtatcaaatatatcatgatttttagaaaccaagtacctaaagagcaactg
ttgttatctattcctcttttaatcaatcatcttcaagcagaaagcattgtggtccatact
tatgcagcacatgctcttgaaaggctgtttaccatgagagggacgaacaatacgacactc
attacagctgcagaaatggcaccatttgtagaagtgctgttaacaaaccttttcaaagca
ttaacgcttcctggctcatcagaaaatgaatacatcatgaaagcaatcatgaggagtttt
tctctgctacaggaatccataattccatacatcccttctgtcatcacacagcttacacag
aagctactggctgtcagtaagaatccaagcaaacctcacttcaaccattacatgttcgaa
tcgatatgcttgtcgataaggataacgtgcaaagcaaaccctgatgctgttggaagcttt
gaggaggctttgtttatggtgttcactgagatactacagaatgatgtgcaagagttcatt
ccatatgtgtttcaagtgatgtccctgcttctggaaatgcacaaaaatgaaatcccatca
tcctatatggcattgtttcctcatctacttcagccagtgttatgggaaaggacaggaaat
attcctcctctggtccgactcctgcaggcttatttagagcgaggtgccaacacaatagca
agtgctgctgctgacaaaattcctgggctgttaggtgtgttccagaagttgattgcctct
aaagctaatgaccatcaaggattctatcttctaaacagtattatagagcatatgccccct
gaatcagttgaccaatacaggaaacagatcttcattctactgttccaaagacttcaaaat
tccaaaacaacaaaatttattaaaagtttcctagtcttcattaacttgtactgcgtaaaa
tacggagcattagctcttcaagaaatatttgacagcatacagccaaagatgtttggaatg
gttctggagaaaattataattcctgaaatacagaaagtgtccggacaagtggaaaagaaa
atctgtgcagttggcattacgaaaatattaacagaatgtcctcctatgatggacactgaa
tacaccaagctgtggactcctttgctgcaggcactcattggcctttttgagctgcctgag
gatgacactatccctgatgaagaacacttcattgacatagaagatactccaggatatcag
actgcattctctcagctagcctttgctggaaagaaagaacatgatcctgtaggtcagatg
gtgaacaatcctagaattcatctggcacagtctcttcacaaactgtctactgcgtgtccg
ggcagggtcccatcaatgctgagtactagtctgaatgcagaagcgttgcagtatctccaa
ggatacctccaagctgcgagcgtgacgctgctctga

DBGET integrated database retrieval system