KEGG   Gallus gallus (chicken): 419249
Entry
419249            CDS       T01006                                 

Gene name
MYT1
Definition
(RefSeq) myelin transcription factor 1 isoform X1
  KO
K23192  myelin transcription factor 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419249 (MYT1)
   03036 Chromosome and associated proteins [BR:gga03036]
    419249 (MYT1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2Cys zinc factors
    419249 (MYT1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     419249 (MYT1)
SSDB
Motif
Pfam: zf-C2HC MYT1 DUF1664
Other DBs
NCBI-GeneID: 419249
NCBI-ProteinID: XP_015152111
CGNC: 4432
Ensembl: ENSGALG00000005932
Position
20
AA seq 1187 aa
MKLCGTFLENEFRGELLNQRWTCGEKISSCEGAASLHGTCIKMSLENDDKRARTRSKSVR
VPTELISQEVSCPTPGCNGSGHIRGKYARHRSLQSCPLAKKRKLQDAEAEHLVSKRKSHP
LKLALDEGYNVDSDGSEEAEVKEESGSEESEGTLEEDEAEVVEQEETRSPEPAEERSPAK
SAHYGQKPATSTSGPSKANYSNYQEIIANSLLNLGQIAEETLAIEGQLPEAELQVSKPPS
NVVHLVHEDAGEEIVEEECDKEIIIQTEDAEEVIEVTSERSSELCPEHQDDTNCEESCKL
QKAMQTEAEEEDEEDEDEDEDEDEEEEEEEEEEEEEEEEEEEEEMAPEVICEEAPHTSQD
TQKSHCEGQFSPKPEYSVIVEVRSDDDKDDDAHSQKSAVTDESEMYDMMTRGNLGLLEQA
IALKAEQVKIVREPSRLPGEHVKHFQVDEKQSKPLDSIRKSYYGKDPSRPEKREIKCPTP
GCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHR
SLSGCPIAAAEKLAKSHEKQQTQSGDPSKPSSNSDRILRPMCFVKQLEIPQYGSYRPNMV
PATPRANLAKELEKYSKVTFDYASFDAQVFGKRMLAPKIQTSETSPKAFKSKPFPKASSP
SHSPSSSYVKSTSSSSTGFDYSHDAEAAHMAATAILNLSTRCWEMPENLSTKQQEAPGKS
MDIEVDENGTLDLSMNKNRKRESTFPSSSSCSSSPSVKSPDVSQRQNSTSATSSTMTSPQ
SSQTSRQDEWDGPIDYTKPNRQREEEPEESEPAAHSFASSEADEQEVSEENFEERKYPGE
VTLTNFKLKFLSKDIKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAH
SADLKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGIKITPTKDDKEDPELMKCPVPGC
VGLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHAN
GSFLTHRSLSGCPRATFAGKKGKLSGDEILNTKFKTSDVLENDEEIKQLNKEISELNESN
SEMEAAMVKLQSQISSMEKNLKNIEEENKIIEEQNEALFLELSGLSQALIQSLANIRLPH
MEPISEQNFDAYVNTLTDMYTNQECYQNPENKDLLESIKQAVKGIQV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgaagctctgcgggactttcctcgaaaatgagtttcggggtgagctgctgaaccagagg
tggacctgtggagagaagatcagcagctgcgagggagccgccagcctgcacggcacgtgc
atcaagatgagtttagaaaatgacgataagagagcacgcacgcgatcgaagtccgtcaga
gtgcccacggagctcatcagccaggaggtgagctgtccaaccccaggctgtaacggctca
ggacacatccgtggaaagtatgcaagacacagaagtctgcaaagctgccctctagcaaag
aagaggaaacttcaagatgcggaggccgaacacctggtgtcgaagcgcaaatcccacccg
ctcaagctggccttggatgaaggctacaacgtcgacagtgacggcagcgaggaggccgag
gtgaaggaggagtccggctctgaggagtcagagggaacgctggaggaggatgaggcggag
gtggtggagcaggaggagacccgcagccccgagccggcagaagagagaagcccagcaaaa
tcagcccattatgggcaaaaaccagcaacaagtacgtctgggcccagcaaggccaactat
agcaactaccaagaaataatcgccaactctctcctaaacctaggccaaatagcagaggaa
accctcgccatcgaagggcagctgcctgaagctgagctgcaggtgtccaagccgccgtcc
aacgttgtgcacctggtccatgaggatgcgggagaggagatcgtggaggaggagtgtgac
aaggagattatcatccagactgaggatgcggaggaagtcatcgaggtcaccagtgaacgc
agcagtgagttgtgtccggagcaccaggacgacacgaactgcgaagagtcctgcaagctg
cagaaggccatgcaaactgaagcagaggaagaagatgaggaggatgaagatgaggatgaa
gatgaggatgaggaagaggaggaggaagaagaagaggaggaggaggaagaagaagaagag
gaggaggaagaaatggctcccgaagtgatctgtgaagaagctcctcacacttctcaggac
acgcagaaaagtcactgtgaagggcagttcagccctaagcccgagtactcggtcatcgtg
gaggtccggtcggatgatgacaaagatgatgacgcccactcccagaagtctgcggtgacc
gacgagtcagaaatgtatgacatgatgacgagggggaacctggggctgctggaacaagcc
atcgcactgaaagctgagcaggtgaaaattgtgagggagcccagccggctgccaggagag
catgtaaagcacttccaggtcgacgagaagcagagcaaaccactggacagcatccgaaag
agctactatggcaaagatccctcaagacctgagaagcgagaaatcaaatgtccaactcct
ggctgcgatgggactggccatgtcacaggactctaccctcaccaccgcagcctctctgga
tgtccgcacaaagacaggatcccccctgagatcttggcgatgcatgagaacgtgttgaaa
tgccccacgccaggctgcacaggacagggtcacgtcaacagcaaccgcaatacgcacagg
agtttatctgggtgccccattgctgctgctgaaaaattagccaaatcacacgaaaagcaa
caaacccagtctggtgatccttcaaagcccagctccaactctgaccggatcctcaggcct
atgtgctttgtgaagcagctggagatccctcagtatggaagctaccggcccaacatggtc
ccagccaccccccgggccaacctggccaaggagctggagaagtactccaaggtcaccttc
gattatgcaagttttgatgctcaggtttttggcaaacgcatgcttgccccaaagattcag
actagcgaaacctcacctaaagcctttaaatccaaaccttttccaaaggcctcttccccc
agccacagcccctccagcagttacgtgaagagcacttcatcttcctccacaggcttcgac
tactcccacgacgccgaggctgctcacatggctgccaccgccatcctcaacctctccacg
cgctgttgggaaatgccggagaatctcagcaccaagcagcaagaggcgcccggcaagtcc
atggacattgaggtggatgaaaatgggactctggacttgagtatgaacaagaaccgcaag
cgggagagcacatttcccagcagcagcagctgcagcagtagtcccagcgtgaagtcccca
gatgtgtcccagcgccaaaacagcaccagtgccacgagcagcaccatgacctccccccag
tccagccagacctcccgccaggacgaatgggacggacccattgactacactaaaccaaac
cgtcagcgggaagaagagccagaagagtcagagcccgcagcccactcttttgcctcctcg
gaagctgatgagcaagaagtgtcggaggaaaactttgaagaacgaaaatatccaggggaa
gttaccttaactaacttcaagcttaaattcctctccaaggacatcaagaaagagctgctc
acttgccctaccccaggctgtgatggcagtggacacatcacgggaaactatgcctctcac
cgcagcctttctggttgtcctcttgctgacaagagcctcagaaacctcatggctgcccac
tctgctgacctcaagtgccctactcctggctgtgacggctctggtcacataacaggaaat
tatgcatcacacagaagtctgtcaggctgccctcgtgccaagaaaagtgggatcaagata
accccgaccaaggatgataaagaagacccggagctgatgaagtgtccggttcctggctgc
gttgggcttgggcacatcagtggtaaatatgcctcccaccgcagtgcatcaggctgcccc
ctggccgcccgaaggcagaaggaaggatccctcaatggctcctcattttcctggaaatca
ctgaaaaacgaaggcccaacctgccctaccccaggctgcgatggctccggccatgccaat
ggaagcttcctcacacacaggagtttgtcagggtgcccaagagctacttttgctgggaag
aaaggaaaactctcaggggatgaaattctcaacacaaagttcaagaccagtgatgttcta
gagaacgatgaggagatcaagcagctgaacaaggagatcagtgagttgaacgagtccaac
tcggagatggaggcagccatggtgaagcttcagtcgcagatctccagcatggagaagaac
ctgaagaacattgaggaggaaaacaagatcatagaggagcaaaacgaagccctgttcctg
gagctctcagggttgagccaggctctaatccaaagtcttgccaatatccgccttccgcac
atggagcccattagtgagcagaactttgatgcgtacgtgaacacgctgactgacatgtac
accaaccaggagtgctaccagaacccagagaacaaggacctgctggagagcatcaagcaa
gccgtcaagggcatccaagtttag

DBGET integrated database retrieval system