KEGG   Gallus gallus (chicken): 419293
Entry
419293            CDS       T01006                                 

Gene name
LBP
Definition
(RefSeq) bactericidal permeability-increasing protein isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Other DBs
NCBI-GeneID: 419293
NCBI-ProteinID: XP_004947243
CGNC: 50963
Ensembl: ENSGALG00000006756
UniProt: F1NXX9
Position
20
AA seq 481 aa
MAARSVAVFGVVLDVFLVLTAATNPGFVVRITQAGLDYAHQHGITVLQKELAQLKLPDIS
GDFPVRHLGKVHYEISSLNLRSFQLPYSRISLVPNVGLHVAISNAFAEVDGNWRVKFHFI
RDHGSFDLEVKNVYIKIDLKLGNDASGKPTVSTSACSTRISSVHVHFSGKFGWLYNLFYS
AVESRFRKILEGKVCDSVVSSVNGDLQRYLQTLPVTAKIDAKAGIDYSLVAPPAATEQTL
DVDLKGEFFSLAHRGAVPFQPPALALPPDHDRMVYFGASSYFFNTAGFAYHAAGALVFEI
TDSMIPKGVEFHLNTSTFAAFIPQLDKMYPNMLMKLRLSAPSAPFLSITPGGISLQPVAD
IQAYAILPNTSLAPLFLLSLTGNVSATIDVKSGHIVGKLSVGRMKLSLKHSDVGTFQVRM
LQSIMNVYASSILLPRVNERLAEGFPLPLPDRIQLSNILVQFHQNFLLLGADVHYTPRER
R
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcagcacggagcgtggcggtgtttggagtggtgctggatgtgttcctggtgctcact
gcagccaccaaccccggcttcgtggtcaggatcacccaggcgggcctggactatgcccac
cagcatgggattaccgtcctgcagaaggagctggcccagctgaagctgccggacatctca
ggtgactttccagtccggcacctggggaaggtgcactatgagatctccagtttgaacctg
cgcagtttccagctgccgtactcacggatctccctggtccccaacgtggggctgcacgtc
gccatctccaacgccttcgccgaggtggatgggaactggcgggtgaaatttcacttcatc
cgggaccacggatccttcgacctggaggtgaagaatgtctacatcaagatcgatctgaag
ctgggcaacgacgcctcggggaagcccaccgtgagcacttctgcctgcagcacccgcatc
tccagtgtccacgtccacttctcgggcaagtttgggtggctgtacaacctcttctatagc
gccgtcgagtccaggttcaggaaaatcttggagggcaaggtttgtgacagcgtggtcagc
tctgtcaacggcgatctgcagcgttacctccagaccttgccagtcacggccaagatagat
gccaaggctgggattgattactccttggtggcaccaccagcggccactgagcagaccctg
gatgtagacctgaagggtgaattcttctccctggcacaccgtggtgctgttcccttccaa
ccgccagcgctggcccttcctcctgaccacgaccgcatggtttactttggggcctccagc
tacttcttcaacactgctggcttcgcctaccatgcagccggggcactggtcttcgagatc
acagactccatgatcccgaagggtgtcgaattccatttgaacacctccacctttgcagcc
ttcattccccagctggacaagatgtaccccaacatgctgatgaagctcaggctgtctgct
ccctctgccccattcctgagcatcacaccaggcgggatctcactccagcccgttgcggac
atccaggcttatgccatccttcccaacaccagcctggcccctctattcctcctcagtttg
acaggcaacgtgtccgccaccattgatgtgaaatctggccacatcgtagggaaactgagt
gtgggcaggatgaagctctctctgaagcattcagatgttggcactttccaggtacgaatg
ctgcagtcaataatgaatgtatatgcctccagtatcctgctcccacgtgttaatgagagg
ttagctgaaggtttcccactgccgctgccggaccgaatacagctctccaatatccttgtg
cagtttcaccagaatttcctgctgctcggagcagatgtgcactacacgccccgggagcgc
agataa

DBGET integrated database retrieval system