KEGG   Gallus gallus (chicken): 419346
Entry
419346            CDS       T01006                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04218  Cellular senescence
gga04310  Wnt signaling pathway
gga04370  VEGF signaling pathway
gga04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    419346 (NFATC2)
   04370 VEGF signaling pathway
    419346 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    419346 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    419346 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419346 (NFATC2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    419346 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 419346
NCBI-ProteinID: XP_004947312
CGNC: 6025
Ensembl: ENSGALG00000007963
Position
20
AA seq 926 aa
MSAAAQAAEPDPQDGTPGHCPGPGPARDGSPQEEFDFSILFDYDYLKPIEEPTPHKTNSP
PSGVAYAHDVLDCGLKPCPLPFPSLSADPMGRYGQPDSIGTAPTHPASAAGASAPSPRIE
ITSYPELINSGGPFRSRDTDVLLVEHQSNSATTSPRVTLPVPGFEGYREPLCLSPASSGS
SASFISETNLSPCTSPCVSPNNGPSDDLCPQFQNIHTHYSPRTSPIMSPRTSITEETCLG
QHSPSPRPNSRSSSPGAKRRYSCTQQPSTSPRQSRTPSPQSSPRIPLREDSSTVTYTQLS
SAPLSMDAMNSLPTDPSCAVPTKIWKTSPDPSSMPSHKNSIPCHVFQTVDFHGPCEQEDR
RNSAPESILLVPPSWTKQLMPAIPICSLPVQSLPPLEWPLSSQSGSYELRIEVQPKPHHR
AHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITG
KTVTTTSYEKIIGNTKVLEIPLEPKNNMKATIDCAGILKLRNADIELRKGETDIGRKNTR
VRLVFRVHIPESSGRIISLQAASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQ
NFTAESKVVFTEKTSDGQQIWEMEATVDKDKSQPSMLFVEIPEYRNKHIRTPVKVNFYVI
NGKRKRSQPQHFTYHPVPSIKTEPIDDYDPALICNTVHSGLGTVTQPYYSQHTMVTESPS
CLVATMAPCQQLRSGLSSPDSRYHQQNPAAVVYQRSKSLSPSQLGYQQSSLMATPVAISD
AHRSVLVHTGSPGQTSAVLHHSPGNQQSSPVIHYSPTNQQLRCGSHQEFQHIMCCENFTS
SVARPSQPQVSQAQRLSPSSYPTVIQQQTASGQRAAKNGPPVSDQKEVLPAGVTIKQEQN
LDQAYLDDVNEIIRKEFSGLPARNQT
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgagcgccgctgcgcaggctgcggagcccgacccgcaggacgggacccccgggcactgc
cccggccccggcccggctcgggacggcagcccgcaggaggagtttgatttctctatcctc
ttcgactatgactacctgaagccgatcgaagaaccgactccacataaaaccaacagccca
ccctctggagttgcatacgctcatgatgtcttggactgtggcctcaagccatgccccctg
ccttttcctagcctttctgcagatcccatgggcagatatggacagccagatagcataggg
acagcacctacacaccctgccagcgccgcaggggcctctgctccgagtcctaggattgaa
attacttcatatcctgaactgattaattcagggggtcccttccgcagcagagacacagat
gttcttttggtagaacatcagtcaaactcagctaccactagcccaagggttaccctgcct
gtccctggctttgagggctacagagaaccactgtgtctgagcccagctagtagcggctct
tctgcaagtttcatttcagagacaaatttatctccttgcacatcaccatgtgtttcacca
aataatggtcctagtgatgacctttgtccgcagtttcaaaacatccatactcattattct
cctagaacctctccaataatgtcaccacgaacaagcatcacggaggaaacctgcttggga
caacattcaccatcaccacgtcccaactcaaggtcttcatcaccaggtgcaaaacggagg
tactcttgcactcagcagccttccacttctccacgacagtcaaggaccccctctccacaa
tcctctccgcgcatccccctgagggaagacagctctacagttacttacacgcagttgtcc
agcgctcctctttccatggatgctatgaacagccttcctacagatccttcctgtgctgtt
cccaccaaaatttggaaaaccagtcctgacccttcatcaatgccttcccacaaaaacagc
attccgtgccacgtctttcagactgttgacttccacgggccctgcgagcaggaggacagg
agaaactcagcaccggaatcgattttgttggttcctccatcctggacaaagcaactgatg
ccagcaatacctatctgcagcttgcccgtccagtcactgccgcccctcgagtggccgctc
tccagccagtccggctcctacgagctccgcatcgaggtgcagcccaagccccaccaccgt
gcgcactacgagaccgaggggagccgaggggctgtgaaggccccgactggaggtcatccg
gtggtccagcttcacggttacatggagaacaaacccttgggtcttcagatcttcattggg
acagcagacgaacggatactcaaacctcatgctttctatcaagtccatcgcattacgggc
aaaactgtcaccaccaccagctatgaaaaaattattggcaacaccaaagttttagagatc
ccgctggaacccaaaaacaacatgaaagcaactattgactgtgcggggattttgaagctg
aggaatgcggacatcgagctgcgtaaaggcgagacagacatcggcaggaagaacacccgc
gtccggctcgtcttccgcgtgcacatccctgagtccagcggccgcatcatctctctgcag
gcagcatcaaaccccatcgagtgctcccaaaggtctgctcatgaacttccgatggttgaa
agacaagacattgatagctgcctcgtgtatggagggcagcagatgatcctgacaggacaa
aacttcacagcggagtccaaggtggtgttcacagagaaaacttcagatgggcagcagatc
tgggaaatggaggcaacagtggataaagataagagccagcctagcatgctctttgtagaa
atacctgagtaccggaacaagcacattcgcacacctgtgaaggtgaatttctatgtcatc
aatggtaaaagaaaaagaagccaaccccagcattttacctatcacccagtaccatcaatc
aaaacagagcccattgatgactatgatccagccttaatctgcaatacagtacacagtggt
ctgggaacagtaacacagccgtactattcacagcacacaatggtcaccgaatccccttcc
tgtcttgtggccactatggctccctgccagcagctgcgctcgggcctttcttctcctgat
tctcgataccatcagcagaatccagctgcagtagtataccaaagaagcaagagccttagc
ccaagccagctgggctaccagcagtccagtttgatggctacaccggttgctatttcagat
gcccataggtcagtgctagtgcatactggttccccaggccaaacttcagcagtgctccac
cactctccaggcaaccagcaatcttctccagtgattcactactctccaactaaccagcag
ctgaggtgtggaagtcaccaggaatttcagcacatcatgtgctgtgaaaattttacgtcc
agtgttgcaagaccaagccagccccaagtcagccaagcgcaaagattaagtccaagttca
tatcctaccgtgatccagcagcagacagcttcaggccagcgagcagcaaaaaatggacca
ccagtcagcgaccagaaagaagtattaccagctggagtcactattaagcaggagcagaat
ttggaccaagcatacctggatgacgttaatgaaattatcaggaaggaattttctggactc
cctgccagaaatcagacatag

DBGET integrated database retrieval system