KEGG   Gallus gallus (chicken): 419368
Entry
419368            CDS       T01006                                 
Symbol
VAMP3
Name
(RefSeq) vesicle-associated membrane protein 3
  KO
K13505  vesicle-associated membrane protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04130  SNARE interactions in vesicular transport
gga04145  Phagosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    419368 (VAMP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    419368 (VAMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    419368 (VAMP3)
Membrane trafficking [BR:gga04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    419368 (VAMP3)
SSDB
Motif
Pfam: Synaptobrevin ASFV_J13L CD34_antigen RIFIN ODV-E18 DUF3619 Baculo_F MCU ERM_helical
Other DBs
NCBI-GeneID: 419368
NCBI-ProteinID: NP_001034578
CGNC: 359
Ensembl: ENSGALG00000000579
UniProt: F1P4I3
Position
21:complement(310699..314464)
AA seq 104 aa
MSANVPGNTNVPAGSNRRLQQTQHQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAG
ASQFETSAAKLKRKYWWKNCKMWAILIAVVVIIIIIIIVVSVSK
NT seq 315 nt   +upstreamnt  +downstreamnt
atgtcagccaatgtccctggaaacacaaatgtgcctgctggcagtaaccgtcgacttcag
caaactcaacatcaagtagatgaggttgttgacatcatgagggtgaatgtggacaaggtg
ctggaaagagatcagaagttgtcggagttggatgaccgtgctgatgcgctgcaagcggga
gcttcccagtttgagaccagtgcagccaagctgaaaagaaagtattggtggaagaactgt
aagatgtgggcaatattgatagctgttgttgtcataatcatcatcatcattattgttgtg
agcgtgtccaaatga

DBGET integrated database retrieval system