KEGG   Gallus gallus (chicken): 419388
Entry
419388            CDS       T01006                                 

Gene name
PRDM16
Definition
(RefSeq) PR domain zinc finger protein 16 isoform X1
  KO
K22410  [histone H3]-lysine9 N-methyltransferase [EC:2.1.1.367]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    419388 (PRDM16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419388 (PRDM16)
   03036 Chromosome and associated proteins [BR:gga03036]
    419388 (PRDM16)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     419388 (PRDM16)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    419388 (PRDM16)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     419388 (PRDM16)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_11 zf-BED SET zf-C2H2_8 zf-met
Other DBs
NCBI-GeneID: 419388
NCBI-ProteinID: XP_004947435
CGNC: 719
Ensembl: ENSGALG00000036728
Position
21
AA seq 1276 aa
MGTQFLGIRRCLFAVVGEENSKCDSEIVNNMYETDPDLLAGESAEEETEDSIMSPIPVGP
PSPFPTSEDFTPKEGSPYEAPVYIPDDIPIPPDFELRESSIPGAGLGIWAKKKIEVGERF
GPYMTVQRSTLKETNFGWEQILTDPEVTSQEGSIKKIADDLGNEKFCIDANQSGAGTWLK
YIRAACSCAEQNLAVCHVNDQIYYKVIKEIEPGEELLVCAKEGSYSLGNMAPSMEEEHTF
RCEDCDELFQSKLDLRRHKKYACSAVSSLYDTLNDEIKQEGLGDGQVFECKDCERMFPNK
YSLEQHMVIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQ
RHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHK
RMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYNPGGIFAPGLPLTPTSMMDKSK
PSPNLNHTSLGFNDYFPSRPHPGGLPFSPAPPAFPALTPGFPGIFPPSLYPRPPLLPPTQ
LLKSPLNHTQDAKLPSPLGNPALPLISAVSNSNQAASAEEKCESSLENSYLEKLKARNSD
MSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDAESDRDKAKDKSKQMESKPDFVSSSVSAS
STNNTSEIPLFYSQHSFFPPPEEHLLPTTGAANDSIKAIASIAEKYFGPGFMGMQEKKMG
SLPYHSMFPFQFLPNFPHSLYPFTERTLNHNLLVKAEPKSPRDLHKVGSTSSESPFDLTT
KPKEIKPILPPPKVLPAPSSGEEQPLDLSIGNRIRASQNGGREPRKNHIYGERKLMASEV
LPKISQSQLPQQPSLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQM
SAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGK
IFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFG
QQTNLDRHLKKHEHENVPVSQHSGVITNHLGTSASSPNSESDNHALLDEKEDSYFSEIRN
FIANSEMNQASTLADKRPEMQDIDSNSQCHGLANEKTEDVDDEDEELEEEDDDSLTGKSQ
DETVSPTAEPRGTYEDEEDEEPTSLTMSFDHTRRCIEEDEAGLLDLEQMPNFGKGLDLRK
AAEEAFEVKDVFNSTLDSETIKQTLYRQAKNQAYAMMLSLSENAPLHTSSQNSLGAWLDM
AGAASESGTFNPINHL
NT seq 3831 nt   +upstreamnt  +downstreamnt
atgggtacccaatttctgggcatcaggagatgtctcttcgctgtggtgggagaagaaaac
agcaaatgtgacagcgagattgtaaataatatgtacgagaccgaccctgatctccttgct
ggcgaaagcgcagaggaggaaacagaggacagtattatgtcccccatccctgtcggacct
ccatcaccctttcccaccagcgaggacttcactcccaaggagggctcgccctatgaagct
cccgtctacattcctgatgacattccaatcccaccagattttgaactcagagaatcttcg
attccaggggcagggctagggatttgggccaaaaagaagattgaagttggggaaagattt
ggaccttatatgacagtacaaaggagcacattaaaggaaacaaactttggatgggagcaa
atactgactgatcccgaggtgacctcccaggagggcagcatcaaaaagattgctgacgac
ctgggaaacgagaagttctgcatcgatgccaaccagagcggagctgggacctggctgaag
tacatccgtgcagcctgctcctgtgctgagcagaacctcgccgtgtgccacgtcaacgac
cagatctattataaggttattaaggaaatcgagccgggagaagagctcttggtgtgtgcc
aaggagggcagctattccctggggaacatggcacccagcatggaagaggagcacacgttc
cgctgcgaggactgcgatgagctcttccagtccaagctggacctgcggcggcacaagaag
tacgcgtgcagcgcggtgagctcgctctatgacacactgaacgacgagatcaagcaggag
ggcctcggcgatgggcaggtgtttgagtgcaaggactgcgagaggatgttccccaacaag
tacagcctggagcagcacatggtgatccacaccgaggagcgggagtacaaatgcgaccag
tgccccaaggccttcaactggaaatccaacctgatccgccaccagatgtctcacgacagc
gggaagcgctttgagtgtgaaaactgcgttaaggtgtttaccgaccccagcaacctccag
aggcacatccgctcccagcacgttggagcacgagcccacgcctgcccggactgcggcaaa
acctttgccacctcatctggcctcaaacagcacaagcacattcacagcactgtcaaacct
ttcatatgtgaggtctgtcacaaatcctacacgcagttctccaacctctgccgccacaag
cggatgcacgcggactgccgcacgcagatcaagtgcaaggactgcgggcagatgttcagc
actacctcctctctcaacaagcaccggcgcttctgcgagggcaagaaccattacaaccct
gggggcatttttgcgccgggcctccccttaacgcccacctccatgatggacaaatccaag
ccctctcccaacctcaaccacaccagcttgggatttaacgattattttccatcccgtccc
cacccggggggtcttccattctcacccgcccccccagcgttccctgccctcactccggga
ttcccggggattttcccaccatctctatacccccggccccccttgttaccacccacacag
ctcctcaaaagtcccctcaaccacacccaggacgcaaagcttcccagccccctcgggaac
cctgcacttcccctcatctctgcggtgagcaacagcaaccaggccgcctcggcagaggag
aaatgcgagagcagcctggagaactcctacctggagaagctaaaagccaggaacagcgac
atgtccgatggcagcgacttcgaggacgtcaacacgaccacgggcacagacctggatacc
accactggcaccggctccgacctggacagcgacgcagagagcgacagggacaaagcaaaa
gataagagcaaacagatggagagcaagccagactttgtgagcagctctgtgtcggcgagc
tccaccaacaacacaagcgagatccctctcttctattctcagcattccttctttcctccc
ccagaagagcacctgctgcccaccacaggagcagctaatgactctattaaggctatcgcc
tccatcgcagagaagtattttgggcctggctttatggggatgcaggagaaaaagatgggt
tcgctcccgtatcattccatgtttccgtttcagttcctccccaatttcccccactcactc
tacccgttcacggagcgaaccctcaatcacaacttgctggtcaaggcagaaccaaagtca
cccagggacctccacaaagtgggcagcaccagctcggagtcgcccttcgatctcaccacg
aagccaaaagagataaagccaatcctgccgccgccgaaggtcctgccagccccgtcctca
ggggaggaacagccactggatctgagcatcggcaaccgcatccgagccagtcagaatgga
gggagagagccacggaagaaccacatctacggggaaaggaaactaatggcaagtgaagtc
ttacccaagatttcccagtctcagctgcctcagcaaccatccctgcattatgctaagcca
tcaccctttttcatggatcccatctacagcagggtggagaagcggaaggtgacagaccct
gtgggtgccctaaaggagaagtacctgcgaccctccccgctgctattccacccccagatg
tcagccatagaaacgatgacggagaaactggagagctttgcagccatgaaggcggactcc
ggcagttccctgcagccccttccccaccaccccttcaacttccgatcgccaccacccaca
ctgtccgaccccatcctgaggaagggcaaggagcgctacacctgcaggtactgtgggaag
atcttccctcgctcagccaacctgacgaggcatctgcggacgcacaccggagagcagccc
tacaggtgtaaatactgtgacaggtcattcagcatttcctccaacctccagcggcacgtt
cggaacatccataacaaggagaagccattcaaatgccacctgtgcaaccggtgctttggg
cagcagaccaacctggaccgacatcttaagaagcacgagcacgagaacgttccagtgagc
cagcactctggagtcattacgaaccaccttgggaccagtgcctcttcccccaactcggag
tcggacaaccatgcacttttagatgagaaagaggattcgtatttctctgaaatcagaaat
tttattgcaaatagtgagatgaaccaagcgtcaacgttagcagataaaaggccagaaatg
caggacattgacagcaactcccagtgtcacggcttggcaaatgagaaaacggaagacgtg
gatgatgaagatgaagaactggaagaggaggatgacgacagcctgacagggaagtcgcag
gatgaaacggtgtcacccactgcagagccccgaggaacgtacgaggatgaagaagatgag
gagcccacatctctcaccatgagctttgaccacacccgaaggtgtattgaggaggacgaa
gccggcttgttagatttggagcagatgccgaattttgggaaggggctggatcttcgcaaa
gcagccgaggaagcatttgaagttaaagatgtgtttaattccaccttagactctgagaca
ataaaacagactctgtacaggcaggctaaaaaccaggcttatgcaatgatgctgtccctg
tctgagaacgctcccctccacacgtcctcccagaactccctgggtgcttggttggacatg
gcaggagcagcttcagagtcggggacctttaaccccatcaaccacctctga

DBGET integrated database retrieval system