KEGG   Gallus gallus (chicken): 419392
Entry
419392            CDS       T01006                                 

Gene name
HES5
Definition
(RefSeq) transcription factor HES-5
  KO
K06055  hairy and enhancer of split 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    419392 (HES5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419392 (HES5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    419392 (HES5)
SSDB
Motif
Pfam: HLH Hairy_orange DUF5630
Other DBs
NCBI-GeneID: 419392
NCBI-ProteinID: NP_001012713
CGNC: 773
Ensembl: ENSGALG00000001141
UniProt: Q5D212
Position
21
AA seq 157 aa
MAPSALSLEILTPKEKNRLRKPIVEKLRRDRINSSIEQLKLLLEKEFQRHQPNSKLEKAD
ILEMTVSYLKYSRAFAASAKSLQQDYCEGYAWCLKEALQFLSLHSANTETQMKLICHFQR
SQAMPKDSGSPSASTSTHQPSAKQTPVKPSCNLWRPW
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcacccagcgctctctccctggaaatcctgacacccaaagagaagaacagactcaga
aaacccattgtagagaaactgcgtcgcgataggattaacagcagcattgagcagctgaag
ctgctcctggagaaggagttccagagacaccaacccaactccaagctggagaaagccgac
atcctggagatgactgtcagctacctgaaatacagccgagcttttgcagcctctgccaaa
agcctacagcaggattactgcgaagggtatgcctggtgcctcaaagaagctctgcaattc
ctgtctctccattcagcaaacacagaaactcagatgaagctgatctgccatttccagagg
tcacaagcaatgcccaaggactccggttctccttctgcatccacttccactcaccagccc
tcagcaaaacaaacaccagtgaagccttcctgcaacctctggaggccttggtag

DBGET integrated database retrieval system