KEGG   Gallus gallus (chicken): 419399Help
Entry
419399            CDS       T01006                                 

Gene name
PRKCZ
Definition
(RefSeq) protein kinase C zeta type isoform X3
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
gga04530  Tight junction
gga04910  Insulin signaling pathway
gga04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    419399 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    419399 (PRKCZ)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    419399 (PRKCZ)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    419399 (PRKCZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    419399 (PRKCZ)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     419399 (PRKCZ)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   419399 (PRKCZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like Haspin_kinase FTA2 Kdo APH C1_2
Motif
Other DBs
NCBI-GeneID: 419399
NCBI-ProteinID: XP_004947451
CGNC: 866
Ensembl: ENSGALG00000001270
Position
21
AA seq 491 aa AA seqDB search
MKAMYPKNPDESIYRRGARRWRKLYRVNGHLFQAKRFNRRAYCGQCSERIWGLSRQGYKC
INCKLLVHKRCHILVPLTCKRHMDSVMPSQEPQLGDKNDEVDLPSEENDGIPYIPSNRKH
DSIKDDSEDIKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMK
VVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFH
MQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDAEGHIKLTDYGMCKEG
LGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMN
TEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCQPQTGFSDIKSHTFFRSI
DWDLLEKKQTTPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDIIKRIDQSEFEGFEYI
NPLLLSTEETV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgtatccaaaaaaccctgacgaatcaatctaccgacgtggagccagaaga
tggaggaagctgtaccgagtgaatgggcatttgtttcaagccaaacgttttaacagaaga
gcgtactgtggccagtgcagtgaaaggatatggggtctcagcaggcaaggctacaagtgt
atcaactgcaaattgttggtccataaacgttgtcacatacttgttccactgacctgcaaa
aggcatatggattcggtcatgccttcccaggaacctcagttaggtgataaaaatgatgaa
gttgacctcccttcagaagaaaatgatggaattccttacattccctcaaaccggaagcat
gacagcattaaagatgactctgaggatatcaaaccagtcattgatggaatggatggaatt
aagatttctcaggggcttgggctacaggactttgatttaatcagagttattggacgtgga
agctatgccaaagttcttttagttcggttaaaaaagaacgatcaaatctatgcgatgaaa
gtagtgaaaaaagaattggtccatgatgatgaggatattgattgggtacagacagagaaa
catgtgtttgaacaggcatccagcaacccattcctagttggtttacattcgtgctttcaa
acaacaagtcgattatttcttgtcatagaatatgtaaatggaggagaccttatgtttcat
atgcaacggcaaaggaaacttcctgaagaacatgcaaggttttatgctgctgaaatttgt
attgctctgaacttcctacatgaaagaggcataatctacagagatctaaaactagacaat
gttcttttagatgctgagggtcatatcaaattaacagattatggcatgtgcaaggaagga
ttgggccctggtgacacaacgagcactttctgtggaacaccaaattacattgcaccggaa
atcctaagaggagaagaatatgggttcagcgtggactggtgggctcttggtgtattgatg
tttgaaatgatggcaggaaggtctccatttgatatcattactgacaatccagacatgaac
actgaagattacctctttcaagttattcttgagaagccaatccggattccaaggtttctt
tctgtcaaggcctcccatgtgttaaaaggatttttaaacaaggatcccaaggaaaggctt
ggatgtcagccacaaacaggattttctgatatcaagtctcacacgtttttccgcagcata
gactgggatctgctggaaaagaaacaaacaacccctccatttcagcctcagatcacagat
gattatggtttggacaactttgatacgcagttcaccagtgaacctgtgcagctaacccca
gatgatgaagatataataaaacgaatagaccagtcagaatttgaaggatttgaatatatt
aatccattgttgctgtcaacggaagaaacagtatga

DBGET integrated database retrieval system