KEGG   Gallus gallus (chicken): 419412
Entry
419412            CDS       T01006                                 

Gene name
ATAD3A
Definition
(RefSeq) ATPase family AAA domain-containing protein 3A
  KO
K17681  ATPase family AAA domain-containing protein 3A/B
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gga03029]
    419412 (ATAD3A)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    419412 (ATAD3A)
SSDB
Motif
Pfam: DUF3523 AAA Mg_chelatase AAA_16 RuvB_N AAA_24 Zot AAA_33 AAA_lid_3 AAA_22 Sigma54_activ_2 ATPase AAA_5 RNA_helicase TsaE AAA_7 AAA_18 AAA_28 AAA_11
Other DBs
NCBI-GeneID: 419412
NCBI-ProteinID: XP_015152608
CGNC: 50992
Ensembl: ENSGALG00000035869
UniProt: A0A1D5PVA4
Position
21
AA seq 604 aa
MSWLFGINRGSAPAGGGESGQGAAGLSLPPGPGGGGGPAGSGGAGDRSTPKDKWSNFDPT
GLERAAKAARELDASRHAKDALSLAQMQEQTLQLEQQAKLKEYEAAIEQLKNEQIRVQAE
ERRKTLSEETKQHQARAQYQDKLARQRYDEQMRQQQLANEENLRKQEESVQKQEAMRRAT
VEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESLKTAGMLF
GEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATAVAGRYIEARLGKPSLVRETSRITV
LEALKHPIKVGKRLTSKAQDALEGVVLSPQLEARVRDIAIATRNTKKNKSLYRNILMYGP
PGTGKTLFAKKLAVHSGMDYAIMTGGDVAPMGREGVTAIHKLFDWANTSRRGLLLFVDEA
DAFLRKRATEKISEDLRATLNAFLHRTGQHSNKFMLVLASNQPEQFDWAINDRIDEMVNF
DLPQLEERERLVRMYFDRHVLKPATEGKQRLKLAQFDYGKKCSEIARLTEGMSGREISQL
AVAWQAAAYASEDGVLTEAMIDARVADAVQQHRQKMEWLKAEGAEASKEGVRTPLLPFPK
GTPV
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgtcctggctcttcggcatcaaccgcggctcggccccggcgggcggcggcgagtcgggg
cagggagcggccgggctttccctgccgccgggcccgggtggtggcggcgggccggcgggc
agcggaggggcgggggaccgcagcacgcccaaggacaaatggagcaacttcgaccccacg
ggcctggagcgggcggccaaggcggcgagggagctggacgcgtcccgccatgcaaaggat
gcactcagcctggcccagatgcaagagcagaccctgcagctggagcagcaagccaagctg
aaggagtacgaagctgccatagagcaactgaagaacgagcagatacgggtgcaagcagaa
gagagacgaaaaacactcagtgaggaaacaaaacagcatcaagcacgagcccaataccag
gacaaattggcacggcagcgctatgacgaacagatgcgacagcagcaacttgctaatgaa
gagaatctgaggaagcaggaagaatctgtacagaagcaggaagccatgaggcgtgccacg
gtagagcgtgagatggagctgcggcataagaacgaaatgctgcgtgttgaagcagaggca
agagctcgtgccaaggctgagagggagaatgcagacatcatccgagagcagatccgctta
aaggctgcagagcatcgccagacagtgctggagtccctcaagacagcagggatgctcttt
ggggaaggattccgtgccttcgtgacagactgggataaggtcacagccacggtggctggc
ctaaccctgctggctgtgggagtttactctgccaagaatgccactgcagtagcagggcga
tacatagaagcacgtttgggtaaaccttcactggtgagagagacctcacgcatcactgtg
ctggaagcactgaagcaccctatcaaggttggtaaacgtctcaccagtaaggcccaggat
gcccttgaaggagttgttctcagtccccaattagaagcacgtgtgagagatattgccata
gcaacaagaaatacaaaaaagaacaaaagcctatacaggaatattctgatgtatggtcct
cctggcactggaaagacactttttgccaagaaattagctgtgcactcaggcatggattac
gccatcatgacgggtggtgatgttgcccctatggggcgggaaggagtgactgccatacat
aagctctttgactgggcaaacaccagtaggagaggcctcttgctatttgtggatgaagca
gatgcatttctgaggaagagagccacggagaaaatcagtgaagatctcagagcaacgttg
aatgcgttcctgcacagaacagggcagcacagcaacaagtttatgcttgttttagcaagc
aaccagcccgagcagtttgactgggctatcaatgaccgaatagatgaaatggtgaacttt
gatctgccccagctggaagagcgagagaggctcgtgaggatgtattttgataggcatgtc
ctgaagccagccacagagggtaaacaacgtttgaagctggcccagtttgactatggcaaa
aagtgctcggagattgccaggctgacagagggcatgtctggccgagagatctcccagctt
gctgtggcatggcaggctgcagcctatgcatcagaggacggtgttctgaccgaggccatg
attgatgctcgggtcgccgacgccgtgcagcagcacaggcagaagatggagtggctgaaa
gcagagggtgcagaagcaagcaaagaaggggtcagaaccccactgctgcctttccccaaa
ggaacgccggtgtga

DBGET integrated database retrieval system