KEGG   Gallus gallus (chicken): 419416Help
Entry
419416            CDS       T01006                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04330  Notch signaling pathway
gga04916  Melanogenesis
Module
gga_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    419416 (DVL1)
   04330 Notch signaling pathway
    419416 (DVL1)
   04150 mTOR signaling pathway
    419416 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    419416 (DVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_2 Shufflon_N
Motif
Other DBs
NCBI-GeneID: 419416
NCBI-ProteinID: XP_015152604
CGNC: 50995
Ensembl: ENSGALG00000001600
UniProt: F6T4S2
Position
21
AA seq 712 aa AA seqDB search
MAETKIIYHIDEEETPYLVKLPVPPEKVTLADFKNVLSNRPVHSYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAESSHSDTGSQCTESHADLPPPIERTGGIGDSRPPSF
HPNAASSRDGLDNETGTESVISHRRDRHRRRNREGHEDVPRINGHPKLDRHREHPPGYDS
SSTMMSSELESSSFIDSDDDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRMRQIDRSSSF
SSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEP
GDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAKCWDPTPRSYFTIPRAEPVRP
IDPAAWISHTTAMTGAYPRYGMSPSMSITTSTSSSLTSSIPESEKLEESPLTVKSDMATI
VKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHVEGFKDRREARKYASSMLKHG
YLRHTVNKITFSEQCYYVFGDLCGNMAALNLNNGSSGASDQDTLAPLPHPAAPWPLGQGY
PYQYPLPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSNRSNSENSRRALGREKDRKS
AGSGSESDHTACSGGTGTARRERPVSQLSHRSHVSATHSERSHHSHHSYGPPGVPPLYNL
PKLGSKVYGTTSGPPGGPPVRELSSVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggcggagactaaaatcatctaccacatcgacgaagaggaaaccccgtacctggtgaag
ctgcccgtccctccggaaaaagtcactttggctgattttaaaaatgtcctcagcaaccga
cccgtgcacagctacaaattcttcttcaaatccatggaccaggatttcggggtggtgaag
gaggagatctcagatgacaacgcaaagctgccttgcttcaatggaagagtggtgtcctgg
ctggtcctggctgaaagctcccactctgacacaggctcacagtgcaccgagagccacgca
gaccttccgcctcccattgagaggacaggtggcattggagactcccggcctccgtcgttc
cacccaaatgctgccagcagtcgggatggactggacaacgaaacaggaacagagtcagtt
attagccaccgtcgagacagacatcgacggaggaatagagaagggcacgaggatgtccct
cggatcaatggccatcccaaactggacagacatcgtgagcaccctcctggttacgacagc
tcttctaccatgatgagtagcgagctggaatccagcagcttcatcgactcggatgatgat
gacaacaccagcaggttgagcagctccactgagcaaagtacttcatcacggctcatacgg
aagcataagcgcaggaggaggaaacaaaggatgaggcagattgacaggtcatcctcgttc
agcagcatcactgattccaccatgtccctaaatatcatcactgtcacactcaacatggaa
aagtataacttcctgggaatcagcattgtgggacagagcaatgaccggggtgatggtggc
atatacattggctctattatgaaaggaggggctgtggcagcagatggtcgaattgaacca
ggagacatgcttctgcaggtgaatgacgtcaattttgagaacatgagcaatgatgatgca
gtacgggttctacgggaaatagtctccaagccaggacctattagcctaacggtagccaaa
tgctgggaccccactcccaggagttatttcaccatccccagggctgaaccagtgaggcca
attgaccctgcagcgtggatctctcataccacagccatgacgggagcgtacccccgttac
ggtatgagcccctccatgagcatcaccacatctaccagctcctcactaacaagctcaatt
cccgagtcggaaaaattagaagaatctcccttaactgtgaagagcgacatggctactatt
gtcaaggtcatgcagctgccagactcaggccttgaaatccgggacaggatgtggttaaag
attaccatctccaatgcagtaataggggcagatgtcgttgactggctttacacacacgtg
gaaggcttcaaagaccgacgggaggctaggaagtatgccagcagcatgttaaaacacggc
tacctcaggcacactgtgaacaaaatcaccttctcagagcagtgctattatgtctttgga
gacctctgtggcaatatggctgcactgaacctcaacaatggttctagcggagcctccgat
caagatacccttgctccacttccacatcctgctgctccctggccattaggccaaggatac
ccctatcagtatcctctgccccctccatgttttccaccagcataccaagacccaggcttt
agctatggtagtggcagcgcagggagccagcaaagcgaaggaagcaaaagcagcggctcg
aaccgaagcaacagcgagaacagcaggagggctctgggcagagagaaggaccgcaagtcg
gcgggcagtggcagcgagtctgaccacactgcctgcagcggtggcaccggcacggcgcgg
cgggagaggcccgtcagccagctcagccaccgcagccacgtctctgccacccacagcgag
aggagccaccacagccatcattcttacgggcctccgggtgtcccacccctctacaacctc
cccaagctgggctcgaaagtctacgggactacgagcggaccccctggagggcccccggtg
agagaactgagctctgttcctccggagctgacggggagccggcagtccttccagaaggcc
atgggcaacccttgtgaattctttgtcgacatcatgtga

DBGET integrated database retrieval system