KEGG   Gallus gallus (chicken): 419458
Entry
419458            CDS       T01006                                 

Gene name
FBLIM1
Definition
(RefSeq) filamin-binding LIM protein 1 isoform X2
  KO
K24416  filamin-binding LIM protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    419458 (FBLIM1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 LIM domain-containing proteins
  Other lim domain-containing proteins
   419458 (FBLIM1)
SSDB
Motif
Pfam: LIM HTH_Tnp_Mu_2
Other DBs
NCBI-GeneID: 419458
NCBI-ProteinID: XP_015152662
CGNC: 2654
Ensembl: ENSGALG00000003636
UniProt: E1C4X1
Position
21
AA seq 338 aa
MSSPSAVSAMLPRKAEKRMASSVFITLASPRRETAPREQPQAGVSLAVPEGTPRPPVTPA
LPNGESSPRSLAVPSSPPALILSEAPQPPSVEALAPALQQLDLAAPAMLQAPFAFPAELR
PPQVCQGQADKPQWQDANGHIERDSSQDICAFCHKAVGPREPTVEAMRKQYHADCFTCRT
CQRRLAGQRYYQRDGRPTCDACYQATLEKCAKCQGLITERIVRALGKGFHPGCFACAACG
RAIGAESFAVDEQGKVYCVADFYRKFAPMCGACKHPIIPDEDTYKIECLGRSFHESCYRC
ESCGMLLSPEPTEDGCYPLGHHLLCKACHICRQNESSC
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtccagcccctccgccgtttctgcgatgctgcccaggaaggcagagaagaggatggct
tcatctgtcttcatcaccctggcgtccccacggagggagacagcccccagggagcagccc
caggcaggggtgtcactggctgtccccgagggcacccctcgccccccagtgaccccggca
ctgcccaatggagaatcctcccctcgctccctggcagtgccttcatccccaccagctctc
atcctctccgaagcgccccagcccccctccgtggaggcactggctccagctctgcagcag
ctggacctcgcggcacccgccatgctgcaggctccttttgccttccctgctgaattgagg
cctccccaagtttgccaggggcaagcagacaagccgcaatggcaggatgcaaacgggcac
atagagagggacagctcccaagacatctgcgccttctgccacaaagccgtgggcccacgg
gagccaacagtggaggcgatgcggaagcagtaccacgctgattgcttcacctgccggacc
tgccagcgacgcctggccggccagcgctactaccaaagggatggccgccccacctgcgac
gcctgctaccaggccacgctggagaaatgtgccaagtgccaggggctgatcactgagcgc
atcgtgcgtgccctgggcaaaggcttccaccccggctgcttcgcctgcgctgcctgtggc
cgggccattggtgctgagagctttgcggtggatgagcagggcaaggtgtactgcgtggcc
gacttctacaggaaattcgccccaatgtgtggtgcctgcaagcaccccatcatccccgat
gaggacacctacaagattgagtgcctgggacgtagcttccacgagagctgctaccgctgt
gagagctgcgggatgctgctgtcaccggagccgacggaggatgggtgctacccgctgggc
caccacctgctctgcaaagcctgccacatctgccggcagaacgagtcgtcctgctga

DBGET integrated database retrieval system