KEGG   Gallus gallus (chicken): 419467
Entry
419467            CDS       T01006                                 

Gene name
ALDH4A1
Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00250  Alanine, aspartate and glutamate metabolism
gga00330  Arginine and proline metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    419467 (ALDH4A1)
   00330 Arginine and proline metabolism
    419467 (ALDH4A1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     419467 (ALDH4A1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 419467
NCBI-ProteinID: NP_001239033
CGNC: 2784
Ensembl: ENSGALG00000042184
UniProt: A0A1D5PXI1
Position
21
AA seq 551 aa
MWRALRGRGRRCLHHAAIQVTNEPILEFKPGSPERAALQKALAELKGRTESIPCVVGGEE
VWTSAVRYQLSPFNHAHKVAKFCYADKDLINKAINAAVAARKEWDLKPIQDRAQIFLKAA
DMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYALELQGSQPLSVEAST
NSMVYRGLEGFVAAVSPFNFTAIGGNLAGTPALMGNVVLWKPSDTALLSSYAVYKILLEA
GLPPNVIQFVPADGPVFGDAVTSSEHFCGLNFTGSVPTFKRLWKQASENLDRYRSFPRLA
GECGGKNFHLVHSSADVSSVVNGTLRSAFEYGGQKCSACSRLYAPRSLWPQIKEKLLEET
KKIKVGDPVQDFGTFFSAVIDDKSFARIKKWLEHAKTSPNLSILAGGGCDDSVGYFVEPC
IVESQDPTDPIMKEEIFGPILTVYVYPEERYQEVLELIDTTTPYGLTGAVFAQERSIIEE
ARSRLRNAAGNFYINDKSTGAVVAQQPFGGSRISGTNDKPGGPHYILRWTSPQAIKETHV
PLSDWRYAYMQ
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgtggcgggcgctgcggggccgcgggcggagatgcctgcaccatgcagccatccaggtg
accaacgagcccatcctcgagttcaagcccggcagccccgagcgagcagctctccagaag
gcgctcgctgagctgaagggccggactgaatccatcccctgtgtggttggtggggaggag
gtgtggacgtcggcagtgcggtaccaactgtcgccattcaaccatgcgcataaagtggcc
aagttctgctatgctgacaaggacctcattaacaaagccattaatgctgccgtggctgcc
aggaaggagtgggacttgaaacccatccaggaccgggcccagatcttcctcaaagcagcc
gacatgctgagcggcccacggcgtgccgaggtgctggccaagaccatggtggggcagggc
aaaaccgtcatccaggcggagatcgacgcagcagcggagctgatcgacttcttccgcttc
aacgccaagtacgccctggagctgcagggcagccagccgctcagcgtggaggccagcacc
aacagcatggtgtaccgtgggctagagggttttgtggctgctgtctctcccttcaacttc
acagccatcggtggcaacctggcgggcactccggctttgatgggaaacgtggtgctgtgg
aagcccagcgacacggccctgctttccagctacgccgtctacaagatcctgctggaagcc
gggctccctcccaacgtcatccagttcgtgccggcggatgggcccgtgtttggtgatgct
gtcaccagctccgagcacttctgtgggctcaacttcaccggcagcgtgccgactttcaag
cgcctctggaagcaagcatccgaaaacctggaccgctaccgcagcttcccccgcctggcc
ggagaatgcgggggtaagaacttccacctggtgcacagctcggccgacgtgtccagcgtg
gtgaacggcaccctgcgctccgccttcgagtacggcggccagaaatgctcggcgtgctcc
cgcctctacgccccgcgctcgctgtggccccagatcaaagagaagctgctggaggagacc
aagaagatcaaagtgggagaccctgtccaggactttgggacctttttctcagcagtgatt
gatgacaagtcgtttgcacgtataaagaagtggctcgaacacgccaagacgtcccccaac
ctcagcatcttggccgggggtggctgcgatgacagcgttgggtactttgttgagccatgc
atcgtggagagccaggacccgacagaccccatcatgaaggaggaaatttttggacccatc
ctcaccgtgtacgtgtaccccgaggagcggtaccaggaggtgttggagctgatcgacacc
acaacaccctatggcctcacgggggcggtgttcgcccaggagaggagcataattgaggaa
gcccgtagccgtctgcgcaacgcggccggcaacttctacatcaatgacaagtcaacgggc
gccgttgtggcccagcaaccctttgggggctcccgcatctcaggaaccaatgacaagcct
ggtggcccccactacatcctacgctggacatctccccaggccatcaaggaaacccacgtg
cctctgtcagactggcgctatgcctacatgcagtga

DBGET integrated database retrieval system