KEGG   Gallus gallus (chicken): 419478
Entry
419478            CDS       T01006                                 

Gene name
PRDM2
Definition
(RefSeq) PR domain zinc finger protein 2 isoform X1
  KO
K11432  [histone H3]-lysine9 N-trimethyltransferase PRDM2 [EC:2.1.1.355]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    419478 (PRDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    419478 (PRDM2)
   03036 Chromosome and associated proteins [BR:gga03036]
    419478 (PRDM2)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     419478 (PRDM2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    419478 (PRDM2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     419478 (PRDM2)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 419478
NCBI-ProteinID: XP_024998361
CGNC: 3000
Ensembl: ENSGALG00000038780
Position
21
AA seq 220 aa
MNQNTTEPPAVVETLADVPEHVLRGLPEDVRLFPSAVDKTRLGVWATKSILKGKKFGPFV
GDKKKRSQVKSNVYMWEVYYPNLGWMCVDATDPKKGNWLRYINWARSGKEQNLFPLEINR
TIYYKSLKPIAPGEELLVWYNGEDDPEIAAAIEEERASARSRRHSPKAKKDQVEDPAGRS
SHVGPFRNLMERKRLRKAKTRGGRQQIQSRKRLIWILQQI
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaatcagaacacaactgagcctcctgctgtagtggagaccttagctgatgtacctgag
cacgtgcttcgggggcttcctgaggatgtcaggctcttcccatctgctgttgataagaca
aggcttggtgtttgggcaacaaagtcaattttaaaagggaagaaattcgggccttttgtt
ggcgacaagaaaaaaagatctcaagttaagagcaatgtatacatgtgggaggtgtattac
ccaaacctggggtggatgtgtgttgatgcaactgatccaaagaaagggaactggctgcgg
tatataaactgggcacgttcaggaaaggagcaaaacctgtttcctctggagatcaacagg
accatatactacaaaagtttaaagccaatcgcgcccggcgaggagctgttggtgtggtac
aatggggaggacgacccggagatagccgccgctattgaggaagagcgagccagcgcccgg
agccggcggcactccccgaaagccaagaaagaccaagtggaggatccagctggccgtagc
agccatgtaggacccttcaggaacctgatggaaagaaaaagactcaggaaagcaaaaaca
aggggaggaaggcaacagatacaaagcagaaaaagactgatttggattcttcagcagata
tga

DBGET integrated database retrieval system