KEGG   Gallus gallus (chicken): 419492Help
Entry
419492            CDS       T01006                                 

Gene name
DRAXIN
Definition
(RefSeq) draxin precursor
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Draxin
Motif
Other DBs
NCBI-GeneID: 419492
NCBI-ProteinID: NP_001136320
CGNC: 3428
Ensembl: ENSGALG00000004631
UniProt: B6ZI38
Position
21
AA seq 349 aa AA seqDB search
MAASSTFFSPSLFLCVLVLIDITLAVSLDTDMKLKSENNNHLQNQETWPQQPRSGHHHKH
GLAKKGRVLALPVRGQPAGEEALRVGSGAPAMEELVPLGQPAALKQDKDKDVFLGFELPH
AERENQSPGSERGKKQNREQRRHSRRDRLKHHRGKTAVGPSSLYKKPESFEQQFQNLQAE
EATSPTPTVLPFTALDLVVSTEEPPVLPATSPRSQARLRQDGDVMPTLDMALFDWTDYED
LKPEMWPSAKKKEKRRSKSSNGGNETSSAEGEPCDHHLDCLPGSCCDLREHLCKPHNRGL
NNKCYDDCMCTEGLRCYAKFHRNRRVTRRKGRCVEPESANGEQGSFINV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcttccaccttcttctctccgtctcttttcctgtgtgtgctggttcttatt
gacatcacccttgccgtctccctggacactgacatgaagctcaaaagtgagaacaacaac
caccttcaaaaccaagagacgtggcctcagcagcccaggagtgggcaccaccacaagcat
ggcttggccaagaaagggagggtccttgccctgcctgttagagggcagccagctggggaa
gaggccctccgagtgggcagtggagctccagccatggaagagctggtgccacttggccag
ccagcagcgctgaaacaggataaggataaggatgtgttcctgggctttgagctcccacac
gctgagcgggagaatcagtcccctgggtctgagaggggaaagaagcagaaccgagagcag
cgacggcacagccgcagggacaggctgaaacaccacagagggaagactgccgttgggcca
agctccctgtataagaaacctgaaagcttcgagcaacagtttcaaaacctccaggcagag
gaagcaaccagcccgacccccaccgtgcttcccttcactgcactggatctggtcgtttcc
acagaagagcctcctgttcttccagccacgtcgccgcggtcacaggcccgcctcaggcaa
gatggggatgtgatgcccaccctagatatggcactctttgactggacagattatgaggac
ctcaaaccagaaatgtggccgtcagctaaaaagaaagagaaacgccgcagtaagagctcc
aatggtggaaatgaaacctcatcggcagaaggagagccgtgtgaccaccaccttgactgc
ctcccaggctcttgctgtgacttgcgtgagcacctctgcaaaccacacaatcgaggcctt
aacaacaaatgctacgatgactgtatgtgcacagaagggctacgctgttatgccaaattc
caccggaaccgaagagtgacccgaaggaaagggcgctgtgtggagcctgagtcggccaat
ggagagcagggatcattcattaatgtttag

DBGET integrated database retrieval system