KEGG   Gallus gallus (chicken): 419494
Entry
419494            CDS       T01006                                 

Gene name
FBXO6
Definition
(RefSeq) F-box only protein 6
  KO
K10100  F-box protein 6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    419494 (FBXO6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    419494 (FBXO6)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:gga04091]
    419494 (FBXO6)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     419494 (FBXO6)
Lectins [BR:gga04091]
 F-box lectins
  419494 (FBXO6)
SSDB
Motif
Pfam: FBA F-box-like F-box
Other DBs
NCBI-GeneID: 419494
NCBI-ProteinID: XP_015152697
CGNC: 51014
Ensembl: ENSGALG00000004646
UniProt: F1NJI6
Position
21
AA seq 260 aa
MATISDLPEDVLVELLSLLPARDLLRACRPVCSQWRDVVDLTTLWKRKCQREGFYVQSLD
RSITDWKVFYLLCKLKRNLIKNPRAEESFKHWKLDQNEGDKWKIEDLPGPLGKELPDSEV
RKYFVTSFGPCFKSQLITLKKEGYWNELMDEKRPEIVVKDWYAARFDCGCRYELRVRLLS
ENYIVLDEFCPEPVVIEQWSDAMWREISHTFSNYPAGVRYIWFQHGGQDTQFWAGWYGIR
VTNSSITIGPQTLKANEDTI
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccatcagcgacctccccgaggacgtgctggtggagctgctgtccctgctgccc
gcccgggacctgctccgtgcgtgcaggccggtgtgctcccaatggcgcgacgtggtggac
ctcaccaccctctggaagcgcaagtgccaacgcgaggggttctacgtgcagagcttggat
aggagcatcaccgactggaaggtgttctacctgctgtgcaagctgaagaggaacttgatc
aaaaatccccgagctgaagagagctttaagcactggaaacttgatcagaatgaaggagat
aagtggaagatcgaggatctgcctggacccctggggaaagagctgccagactcagaagtc
cgcaaatactttgtcacttcgtttgggccatgcttcaaatctcagctgattaccctgaag
aaagaagggtactggaatgagctgatggatgagaaacggcctgaaattgtagttaaggac
tggtacgctgccagatttgactgtggttgtcgctatgagctcagagtgaggctgctttct
gaaaactacattgtgcttgatgagttctgtcctgagccagtggtcatagagcagtggagc
gacgcaatgtggagagagatttcccacaccttcagcaattacccagctggagttcgttac
atctggtttcagcacggaggccaagatacccaattctgggcaggatggtatgggatcagg
gtgacaaacagcagcatcaccattgggccccagacattgaaggcaaatgaagacacaata
taa

DBGET integrated database retrieval system