KEGG   Gallus gallus (chicken): 419548
Entry
419548            CDS       T01006                                 

Symbol
CNKSR1
Name
(RefSeq) connector enhancer of kinase suppressor of ras 1 isoform X2
  KO
K23783  connector enhancer of kinase suppressor of Ras 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    419548 (CNKSR1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   419548 (CNKSR1)
SSDB
Motif
Pfam: CRIC_ras_sig PH PDZ SAM_1 SAM_2 OmpH PDZ_6 GvpG DFRP_C
Other DBs
NCBI-GeneID: 419548
NCBI-ProteinID: XP_015153047
CGNC: 21670
Position
23:complement(344367..350679)
AA seq 800 aa
MEPVGAWGPAQTAAWLRGLDAAVQGYPFEEWGLASTELLRLSEGALEALGVWRVGHQELL
LEAVEQLRALDTEMGSTSLRTLTERLRELAQRTETVVLEESPQGATPQPPPIALLACVVD
LIGAAKRLFSWLNRYLFSTLNDFSSTRDIVLLCARLVEVLQTDCSTAERNSQILLICQHI
IGICESIVGCSPPALLDRRAILQRVGLALPRVPRDSPPDSPSTPMLPSELWSSPPASPST
PVLPPEPPGSPPESPSTPMLPYNPLGLEITSTSSCLHFVSMTNSEPGKLHKAPCCLYLPQ
ALAVHGGRILPGDEIVQVNEQVVVGWTHINLVKKLSESASRVSLVLKKVPLSLPGSPLPP
SQQVPGALLNAVDLPKSSECPSSPSSPASSTTADVDSGPDPTTDEDEHSTSLCRQDVGEL
RPAALSLGAGEDAVWEASTPPGTPSSPCALQPCTAEFSPTAASRAQSAEPRQTTGEGSPE
TVRRPKGVATRLSRRRVSCRDLGRVDCDGWLLKKKDHVGFMAQKWKRCWFVLKGHTLYWY
NHPNDDKAAGLINVATYNLESTREQKKKYVFQLSHEKYKPFVFAAETLADLSMWVSHLIT
AKTKHALAHQPIPHREEDCYSETEAEDPDDESPRHGCDSPKKRLQNTPEKAQLFQTSSES
SSPQSSPQPHSPVEPCEEDLESLMWCLRQGGVSLIGRQRFLTQEQCRKSFIRRNKNPRIN
EKVHAVRALQSTLKAKLAELQALEQLLDDAALTSEKFQRWKEEHQDLYQELQEWRARQQG
QDSSGRHKAEQRPATEAAEP
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggagcctgtgggcgcctggggccctgcacagactgcggcctggctgagagggctggac
gcagctgtgcaggggtatccctttgaggagtggggtctggcaagcactgagctactgagg
ctatcagagggagctctggaggcgctgggagtatggcgtgtgggacaccaggagctgctg
ctggaggccgtggagcagctccgagccctggacacagagatggggagcaccagcctgcgg
acattaacagagaggctgcgggagctggcacagcgcactgagaccgtggtactggaggag
tcaccccagggggccaccccacagccaccccccattgccctgctggcctgcgtcgttgac
ctgattggagctgccaagagactcttctcctggctcaacaggtacctcttctccaccctg
aatgacttttcatccactcgggacatcgtcctgctctgtgcccgcctggtggaggtgctg
cagacggactgctctactgcagagaggaacagccagattctgcttatatgccagcacatc
ataggcatctgtgagagcattgtgggctgcagtcctccagcactgctggaccgcagggcc
attctgcagcgcgtggggctggcactgccccgcgtgccacgtgatagccctccagattcc
cccagcacccccatgctgccttctgaactgtggagcagcccccctgcatcccccagcacc
ccagtgctgcctcctgagccaccagggagccctccagaatcccccagcaccccgatgctg
ccctacaacccactgggtctggagatcacctccaccagctcctgcctgcactttgtgtcc
atgaccaactcggagccaggaaagctccataaagctccctgctgcctgtatctgccccag
gccctggctgtgcacgggggtcgcatcctgcccggggacgagatcgtgcaggtcaatgag
caagtggtggttggttggacacacatcaacctggtgaagaagctgtcggagtcggcaagc
agagtgtcacttgtgctgaagaaggtgcccctcagcctgcctggctcccccctgcccccc
agccagcaggtgccaggtgcccttctgaatgctgtggatctccccaaaagcagcgagtgc
cccagcagcccctcatccccagcatccagcaccactgccgacgtggactcagggccggac
cccactactgacgaggacgagcacagcacaagcctgtgcaggcaggacgtgggtgagctc
cgaccggcagcactcagcctcggtgctggggaggacgctgtgtgggaggccagcacccca
ccaggcaccccaagctcaccgtgtgccctccaaccctgcactgcagagttcagccccaca
gcagcctccagggcacaaagtgcagagccccgccagaccaccggggagggcagccctgag
acggtacgcagacccaaaggagtggcgaccaggctgagccgccggcgggtctcatgccgg
gacctgggccgggtggactgcgatggctggctcctgaagaagaaagaccacgtgggcttc
atggcccagaagtggaagcgctgctggtttgtgctgaagggccacacgctctactggtac
aaccaccccaacgatgacaaggctgcaggtctcatcaacgtggccacttacaacctggag
agcacgagggagcagaagaagaaatatgtcttccagctctcccacgagaagtacaagccc
tttgtctttgctgcagaaacactggcagatttgagcatgtgggtcagccacctgattaca
gctaagacgaagcatgcactggcccaccagcccatcccgcacagggaggaagactgctac
agcgagacagaagctgaggaccctgatgatgaatctccccgacatggctgtgactcgcca
aagaaaaggctgcagaacaccccagagaaagcgcagctcttccagaccagtagtgaatcc
agcagcccgcagagcagccctcagccccattcacctgtagagccctgcgaggaggacctt
gagagcctgatgtggtgcctgaggcagggcggggtgtccctcatcgggcggcagcgcttc
ctgacgcaggagcagtgccgtaagtccttcatccggcgcaacaagaacccccgcatcaac
gagaaggtgcacgcagtgcgggccctgcagagcacactcaaggcaaaactggcagagctg
caggccctcgagcagctgctggatgatgctgcgctgacatccgagaagttccagcgctgg
aaagaagagcaccaggacctgtaccaggagctgcaggagtggcgggcacggcagcagggc
caggatagcagtgggagacacaaggctgagcagagacccgcgacagaggcagctgaaccc
tga

DBGET integrated database retrieval system