KEGG   Gallus gallus (chicken): 419570
Entry
419570            CDS       T01006                                 

Gene name
HNRNPR
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein R
  KO
K13161  heterogeneous nuclear ribonucleoprotein R
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    419570 (HNRNPR)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    419570 (HNRNPR)
SSDB
Motif
Pfam: RRM_1 hnRNP_Q_AcD RRM_7 RRM_5 RRM_occluded Calcipressin
Other DBs
NCBI-GeneID: 419570
NCBI-ProteinID: NP_001006309
CGNC: 51033
Ensembl: ENSGALG00000000814
Position
23
AA seq 633 aa
MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDL
DERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTK
GPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDTVYSGVQPGIGTEVFVGKIPRDLYEDE
LVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCSKDAAQEAVKLCDNYEIRPGKHLGVC
ISVANNRLFVGSIPKNKTKENILEEFNKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHK
SAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKS
FSEFGKLERVKKLKDYAFVHFEDRGAAVKAMNEMNGKEIEGEEIEIVLAKPPDKKRKERQ
AARQASRSTAYEDYYYYPPPRMPPPIRGRGRGGRGGYGYPPDYYGYEDYYDDYYGYDYHD
YRGGYEDPYYGYDDGYAIRGRGGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPMGPPR
GARGGRGGPAQQQRGRGARGARGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIA
QQPLQQGGDYAGNYGYNNDNQEFYQDTYGQQWK
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggctaatcaggtgaatggtaatgcggtacagttaaaagaagaggaagaaccaatggat
acttccagtgtaactcacacagaacactacaagacactgatagaggcaggcctcccacag
aaggtggcagagagacttgatgaaatatttcagacagggttggtagcttatgtcgatctt
gatgaaagagcaattgatgctcttagggaatttaatgaagaaggagccctctctgtatta
cagcagtttaaagaaagtgacctgtcgcatgtacagaacaaaagcgcatttttatgtgga
gttatgaagacctacaggcaaagagagaaacaaggcagcaaagtacaggaatcgacaaag
ggaccagatgaagcaaagatcaaggctttgctagagaggactggttacactttggatgta
actacaggacagagaaaatatgggggccctcctccagatactgtgtattctggtgttcag
cctggtattggaacagaggtttttgttggtaagattccccgagacttgtatgaagatgaa
ttggtaccactctttgagaaagctggtccaatttgggatcttcgcctcatgatggatcct
ctttctggtcaaaacagaggttatgctttcattaccttttgtagcaaagatgcagctcag
gaagcagtcaaactgtgtgacaactacgaaatccgtcctgggaagcaccttggagtatgc
atctctgtggcaaacaacaggttatttgttgggtcgattccaaagaacaagacaaaggaa
aacattttggaagagtttaataaagtcacagagggtttggtggatgtaatcttatatcat
caacctgatgataaaaagaagaatcgaggattctgtttcttggaatatgaagatcacaag
tcagcagcacaagctcggcgtcgcttgatgagtggaaaagtaaaagtctggggaaatgtt
gtgacggtggaatgggctgatccagtagaagaacctgatccagaagtcatggcaaaggtg
aaagttttatttgtaagaaacttggccactactgtgacggaagaaattcttgagaaatcc
ttctctgaatttggaaagctggaaagagtaaagaaactaaaggattatgcttttgttcat
tttgaggacagaggtgcagcggtgaaggctatgaatgaaatgaatggaaaagagatagaa
ggggaagaaattgaaatagtgttagcaaagccaccggataagaaaaggaaagaacgtcag
gctgccaggcaggcctccagaagtactgcgtatgaagactattattactaccctccgcct
cgcatgccacctcctattagaggcagaggccgtggagggagaggtggatatggctatccc
ccagattactatggctatgaagattattatgatgattattatggttatgactatcatgac
taccgtggtggctatgaagatccctattacggctatgatgatggctatgctataagagga
agaggaggaggaggaaggggtgggagaggtgcacctccaccacctagggggcggggagca
ccaccaccaagaggtagagctggctattcacagaggggggcacccatgggaccgccaaga
ggagccaggggtgggagagggggtcctgcacagcagcagagaggacgcggtgctcgtgga
gccaggggcaaccgtgggggcaacgtaggaggcaagagaaaggcagatgggtacaaccag
cctgattccaagcgccgtcagaccaacaaccagcagaactggggctcccaacccatcgct
cagcagccgctccagcaaggtggtgactatgccggtaactatggttacaataatgacaac
caggaattttatcaggatacttatgggcaacagtggaagtag

DBGET integrated database retrieval system